Novus Biologicals products are now on bio-techne.com

CD2AP Recombinant Protein Antigen

Name: CD2AP Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-90626PEP
Price: 279 USD

Images

There are currently no images for CD2AP Protein (NBP1-90626PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD2AP Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD2AP. Source: E. coli Amino Acid Sequence: WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CD2AP
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90626. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD2AP Recombinant Protein Antigen

adapter protein CMS
Cas ligand with multiple Src homology 3 (SH3) domains
CD2AP
CD2-associated protein
CMS
DKFZp586H0519

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nephrin Antibody
[Unconjugated]

AF3159

Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]

(58 Publications)

Species: Mu

Applications: IHC

Podocin/NPHS2
Antibody (JB51-33)

NBP2-75624

Immunohistochemistry-Paraffin Podocin/NPHS2 Antibody (JB51-33)

(6 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB

CIN85/SH3KBP1
Antibody

NBP1-85614

Immunohistochemistry-Paraffin CIN85/SH3KBP1 Antibody

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Alpha Actinin 4
Antibody (4D10)

H00000081-M01

Western Blot Alpha Actinin 4 Antibody (4D10)

Immunocytochemistry/ Immunofluorescence Alpha Actinin 4 Antibody (4D10)

(4 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

CBL Antibody
(3B12) - BSA Free

NBP2-37574

Western Blot CBL Antibody (3B12) - BSA Free

(1 Review)

Species: Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

BDNF [HRP]

DBD00

(104 Publications)

Species: Hu

Applications: ELISA

CD2 Antibody
(RPA-2.10)

NBP2-25200

(1 Review)

Species: Hu

Applications: B/N, Flow, IHC, IHC-Fr, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Sialin/SLC17A5
Antibody

NBP2-20383

Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

RanGAP1 Antibody
(OTI1B4)

NBP2-02623

(1 Publication)

Species: Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Synaptopodin
Antibody - BSA Free

NBP2-39100

Western Blot Synaptopodin Antibody - BSA Free

(10 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

WT1 Antibody
(6F-H2) - BSA Free

NB110-60011

Immunohistochemistry-Paraffin WT1 Antibody (6F-H2) - BSA Free

(3 Reviews)

(16 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Aquaporin-4
Antibody

NBP1-87679

Immunohistochemistry Aquaporin-4 Antibody

(2 Reviews)

(21 Publications)

Species: Bv, Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, IP, WB

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(49 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

p130Cas/BCAR1
Antibody (OTI1A9)

NBP2-00532

(1 Publication)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Tight Junction
Protein 1 Antibody

NBP1-85047

Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody

(5 Reviews)

(20 Publications)

Species: Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

EGFR Antibody
[Unconjugated]

AF231

Immunocytochemistry EGFR Antibody [Unconjugated]

Western Blot EGFR Antibody [Unconjugated]

(30 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

EGF [Unconjugated]

236-EG

(842 Publications)

Species: Hu

Applications: BA

VEGF [HRP]

DVE00

(684 Publications)

Species: Hu

Applications: ELISA

MT-ATP6 Antibody -
Azide and BSA Free

NBP3-05578

Western Blot MT-ATP6 Antibody - Azide and BSA Free

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for CD2AP Protein (NBP1-90626PEP) (0)

There are no publications for CD2AP Protein (NBP1-90626PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD2AP Protein (NBP1-90626PEP) (0)

There are no reviews for CD2AP Protein (NBP1-90626PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD2AP Protein (NBP1-90626PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD2AP Products

Research Areas for CD2AP Protein (NBP1-90626PEP)

Find related products by research area.

Blogs on CD2AP

There are no specific blogs for CD2AP, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our CD2AP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CD2AP

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

CD2AP Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

CD2AP Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CD2AP Recombinant Protein Antigen

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CD2AP Protein (NBP1-90626PEP) (0)

Reviews for CD2AP Protein (NBP1-90626PEP) (0)

FAQs for CD2AP Protein (NBP1-90626PEP) (0)

Additional CD2AP Products

Research Areas for CD2AP Protein (NBP1-90626PEP)

Blogs on CD2AP

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics