Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human cerebral cortex and liver tissues. Corresponding AQP4 RNA-seq data are presented for the same tissues.
Western Blot: Aquaporin-4 Antibody [NBP1-87679] - Analysis in human brain tissue.
Immunohistochemistry: Aquaporin-4 Antibody [NBP1-87679] - Staining of mouse cerebellum shows positivity in astrocytes, mainly in the molecular layer.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebellum shows moderate to strong membranous positivity in astrocytes, mainly in the molecular layer.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human cerebral cortex shows moderate to strong membranous positivity in astrocytes.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human liver shows no positivity in hepatocytes, as expected.
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP1-87679] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Frozen: Aquaporin-4 Antibody [NBP1-87679] - Mouse trigeminal ganglion stained with Aquaporin-4 antibody at 1:5000. Image submitted by a verified customer review
This antibody was developed against Recombinant Protein corresponding to amino acids: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Marker
Astrocytes Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunohistochemistry-Frozen Validated from verified customer review.
Immunohistochemistry-Paraffin 1:2500 - 1:5000
Immunoprecipitation Reported in scientific literature (PMID: 32843684)
Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Use in Rat reported in scientific literature (PMID:33634832). Bovine reactivity reported in scientific literature (PMID: 31233960).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Aquaporin-4 Antibody
AQP4
AQP-4
Aquaporin 4
MGC22454
MIWC
WCH4
Background
The Aquaporin-4 gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selectivechannels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Twoalternatively spliced tra
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Lee W, Lyu Z, Park J et al. Microphysiological stroke model for systematic evaluation of neurorestorative potential of stem cell therapy Research Square 2021-03-19 (ICC/IF, Human)
Wypych A, Dunis?awska A, Grabowska M et al. Effects of three-month feeding high-fat diets with differentfatty acid composition on kidney histology and expressionof genes related to cellular stress and water-electrolytehomeostasis in mice Journal of Animal and Feed Sciences 2023-06-22 (IHC-P, Mouse)
Mice were perfused with 0.9% saline and subsequently decapitated. The cerebrum was then dissected out of the cranium and the head was put in ~10mL of 4% PFA in 0.1M phosphate buffer overnight. The following morning the trigeminal ganglia were dissected and placed in 30% sucrose (sucrose dissolved in 0.1M phosphate buffer) for at least 48hr. The tissue was then blocked in OCT, frozen, cut at 10 microns (on a cryostat) and mounted on glass slides.
Slides were washed three times with 1X PBS (diluted from a 10X stock (recipe available on thelabrat.com)) and blocked for 1hr in 1X PBS containing 0.2% triton X-100 and 10% goat serum. After the block, tissue was incubated overnight at room temperature in 1X PBS containing 0.2% triton X-100, 2% goat serum, 20mg/mL bovine serum albumin and the primary antibody diluted to a final concentration of 1:5000. The following morning the slides were washed twice with 1X PBS containing 0.2% tween-20 and once with 1X PBS. The slides were then incubated for 45 min (room temperature) in 1X PBS containing 0.2% triton X-100, 2% goat serum, 20mg/mL bovine serum albumin and 488-conjugated goat-anti rabbit secondary (ThermoFisher, 1:200).
After the 45 min incubation period, slides were washed with washed twice with 1X PBS containing 0.2% tween 20 and once with 1X PBS. The slides were then coverslipped and mounted using vectashield mounting medium.
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.