Home » Calcium-binding-protein-P22 » Calcium-binding-protein-P22 Proteins » Calcium-binding-protein-P22 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Calcium-binding-protein-P22 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Calcium-binding-protein-P22 Protein (NBP1-87589PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Calcium-binding-protein-P22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHP1.

Source: E. coli

Amino Acid Sequence: GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87589.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calcium-binding-protein-P22 Recombinant Protein Antigen

  • Calcineurin B homolog
  • Calcineurin homologous protein
  • calcium binding protein P22
  • Calcium-binding protein CHP
  • calcium-binding protein p22
  • SLC9A1 binding protein
  • SLC9A1BP

Background

Calcium-binding-protein-P22 encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DNA Polymerase
epsilon subunit 3 Ant ...
NBP3-08571
Protein Array DNA Polymerase epsilon subunit 3 Antibody (PCRP-POLE3-2F10) - Azide and BSA Free
Immunohistochemistry-Paraffin DNA Polymerase epsilon subunit 3 Antibody (PCRP-POLE3-2F10) - Azide and BSA Free
Flow Cytometry DNA Polymerase epsilon subunit 3 Antibody (PCRP-POLE3-2F10) - Azide and BSA Free
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
ING1 Antibody
AF5758
Western Blot ING1 Antibody
Immunocytochemistry ING1 Antibody
Immunohistochemistry ING1 Antibody
Species: Hu
Applications: ICC, IHC, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AKAP13 Antibody
NBP1-89163
Immunocytochemistry/ Immunofluorescence AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
Immunohistochemistry-Paraffin AKAP13 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NSFL1C Antibody
NBP2-13677
Immunocytochemistry/ Immunofluorescence NSFL1C Antibody
Immunohistochemistry-Paraffin NSFL1C Antibody
Immunohistochemistry-Paraffin NSFL1C Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SCGF/CLEC11a
Antibody (239029) [Un ...
MAB1904
Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, IHC, WB
Cytochrome b245
alpha Antibody (CS9)
NBP1-40974
Flow Cytometry Cytochrome b245 alpha Antibody (CS9)
Flow Cytometry Cytochrome b245 alpha Antibody (CS9)
(1 Publication)
Species: Hu
Applications: ELISA, Flow, IHC, IHC-Fr, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
IL-23A/IL-23 P19
[Unconjugated]
1290-IL
SEC-MALS IL-23A/IL-23 P19 [Unconjugated]
(115 Publications)
Species: Hu
Applications: BA
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin Factor IX Antibody
Immunohistochemistry-Paraffin Factor IX Antibody
Immunocytochemistry/ Immunofluorescence Factor IX Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
p19 INK4d Antibody
(DCS-100)
NBP3-11884
Immunocytochemistry/ Immunofluorescence p19 INK4d Antibody (DCS-100)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB

Calcium-binding-protei ...
NBP1-87589PEP
Calcium-binding-protein-P22 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Calcium-binding-protein-P22 Protein (NBP1-87589PEP) (0)

There are no publications for Calcium-binding-protein-P22 Protein (NBP1-87589PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium-binding-protein-P22 Protein (NBP1-87589PEP) (0)

There are no reviews for Calcium-binding-protein-P22 Protein (NBP1-87589PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calcium-binding-protein-P22 Protein (NBP1-87589PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calcium-binding-protein-P22 Products

Research Areas for Calcium-binding-protein-P22 Protein (NBP1-87589PEP)

Find related products by research area.

Blogs on Calcium-binding-protein-P22

There are no specific blogs for Calcium-binding-protein-P22, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calcium-binding-protein-P22 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CHP1