![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining in human kidney and lymph node tissues using anti-CALB1 antibody. Corresponding CALB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0004.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining in human kidney and lymph node tissues using anti-CALB1 antibody. Corresponding CALB1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CALB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Calbindin D-28K Antibody (NBP2-38798)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human cerebellum, kidney, liver and lymph node using Anti-CALB1 antibody NBP2-38798 (A) shows similar protein distribution across tissues to independent antibody NBP1-86664 (B).](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0005.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human cerebellum, kidney, liver and lymph node using Anti-CALB1 antibody NBP2-38798 (A) shows similar protein distribution across tissues to independent antibody NBP1-86664 (B).")
![Western Blot: Calbindin D-28K Antibody [NBP2-38798] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Western-Blot-NBP2-38798-img0002.jpg "Western Blot: Calbindin D-28K Antibody [NBP2-38798] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG")
![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human lymph node using Anti-CALB1 antibody NBP2-38798.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0009.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human lymph node using Anti-CALB1 antibody NBP2-38798.")
![Immunohistochemistry: Calbindin D-28K Antibody [NBP2-38798] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-NBP2-38798-img0001.jpg "Immunohistochemistry: Calbindin D-28K Antibody [NBP2-38798] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0003.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human cerebellum.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0006.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human cerebellum.")
![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human liver.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0007.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human liver.")
![Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human kidney using Anti-CALB1 antibody NBP2-38798.](http://images.novusbio.com/fullsize/Calbindin-D-28K-Antibody-Immunohistochemistry-Paraffin-NBP2-38798-img0008.jpg "Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human kidney using Anti-CALB1 antibody NBP2-38798.")
![Western Blot Calbindin D/S100G Antibody [Unconjugated]](https://images.novusbio.com/images2/Calbindin_D_AF3320_Western_Blot_17076.jpg)
![Simple Western Calbindin D/S100G Antibody [Unconjugated]](https://images.novusbio.com/images2/Calbindin_D_AF3320_Immunohistochemistry_17486.jpg)
![Immunohistochemistry Calbindin D/S100G Antibody [Unconjugated]](https://images.novusbio.com/images2/af3320_human-calbindin-d-affinity-purified-polyclonal-ab-immunohistochemistry-1612202012853.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")