BMP-6 Antibody (6N5S9) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human BMP-6 (NP_001709.1). DGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLN |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
BMP6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for BMP-6 Antibody (6N5S9)
Background
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Publications for BMP-6 Antibody (NBP3-16430) (0)
There are no publications for BMP-6 Antibody (NBP3-16430).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BMP-6 Antibody (NBP3-16430) (0)
There are no reviews for BMP-6 Antibody (NBP3-16430).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BMP-6 Antibody (NBP3-16430) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BMP-6 Products
Research Areas for BMP-6 Antibody (NBP3-16430)
Find related products by research area.
|
Blogs on BMP-6
![Western Blot: BMP-6 Antibody (6N5S9) [NBP3-16430] - Western blot analysis of extracts of various cell lines, using BMP-6 Rabbit mAb (NBP3-16430) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/BMP-6-Antibody-6N5S9-Western-Blot-NBP3-16430-img0003.jpg "Western Blot: BMP-6 Antibody (6N5S9) [NBP3-16430] - Western blot analysis of extracts of various cell lines, using BMP-6 Rabbit mAb (NBP3-16430) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.")
![Immunocytochemistry/Immunofluorescence: BMP-6 Antibody (6N5S9) [NBP3-16430] - Immunofluorescence analysis of U-2 OS cells using BMP-6 Rabbit mAb (NBP3-16430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/BMP-6-Antibody-6N5S9-Immunocytochemistry-Immunofluorescence-NBP3-16430-img0002.jpg "Immunocytochemistry/Immunofluorescence: BMP-6 Antibody (6N5S9) [NBP3-16430] - Immunofluorescence analysis of U-2 OS cells using BMP-6 Rabbit mAb (NBP3-16430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: BMP-6 Antibody (6N5S9) [NBP3-16430] - Immunofluorescence analysis of NIH-3T3 cells using BMP-6 Rabbit mAb (NBP3-16430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/BMP-6-Antibody-6N5S9-Immunocytochemistry-Immunofluorescence-NBP3-16430-img0001.jpg "Immunocytochemistry/Immunofluorescence: BMP-6 Antibody (6N5S9) [NBP3-16430] - Immunofluorescence analysis of NIH-3T3 cells using BMP-6 Rabbit mAb (NBP3-16430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: BMP-6 Antibody (6N5S9) [BMP-6] - Immunofluorescence analysis of U-2 OS cells using BMP-6 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16430_rabbit-bmp-6-mab-6n5s9-52202517223912.jpg "Immunocytochemistry/ Immunofluorescence: BMP-6 Antibody (6N5S9) [BMP-6] - Immunofluorescence analysis of U-2 OS cells using BMP-6 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: BMP-6 Antibody (6N5S9) [BMP-6] - Immunofluorescence analysis of NIH-3T3 cells using BMP-6 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16430_rabbit-bmp-6-mab-6n5s9-52202517284985.jpg "Immunocytochemistry/ Immunofluorescence: BMP-6 Antibody (6N5S9) [BMP-6] - Immunofluorescence analysis of NIH-3T3 cells using BMP-6 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Bioactivity BMP-7 [Unconjugated]](https://images.novusbio.com/images/protein/354-bp_recombinant-human-bmp-7-protein-bioactivity-7122020141940.jpg)
![Cell Culture BMP-7 [Unconjugated]](https://images.novusbio.com/images/354-bp_recombinant-human-bmp-7-protein-cell-culture-252023113257..jpg)
![N/A Hepcidin Antimicrobial Peptide [HRP]](https://images.novusbio.com/images2/Hepcidin_DHP250_ELISA_1121.jpg)
![N/A Hepcidin Antimicrobial Peptide [HRP]](https://images.novusbio.com/images2/Hepcidin_DHP250_ELISA_1122.jpg)
![Immunohistochemistry Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Immunohistochemistry_10106.jpg)
![Western Blot Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Western_Blot_5162.jpg)
![Simple Western Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Simple_Western_16677.jpg)
![BMP-5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "BMP-5 [Unconjugated]")
![Immunocytochemistry RGM-C/Hemojuvelin Antibody [Unconjugated]](https://images.novusbio.com/images2/RGM-C_AF3720_Immunocytochemistry_12460.jpg)
![Flow Cytometry BMPR-II Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPRII_AF811_Flow_Cytometry_15364.jpg)
![Immunohistochemistry BMPR-II Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPR-II_AF811_Immunohistochemistry_7345.jpg)
![Bioactivity Noggin [Unconjugated]](https://images.novusbio.com/images2/Noggin_6057NG_2865.jpg)
![Bioactivity Noggin [Unconjugated]](https://images.novusbio.com/images2/Noggin_6057NG_923.jpg)
![Bioactivity Noggin [Unconjugated]](https://images.novusbio.com/images2/6057-ng_recombinant-human-noggin-protein-bioactivity-1022023121039.jpg)
![Bioactivity GDF-9 [Unconjugated]](https://images.novusbio.com/images2/GDF9_739G9_1210.jpg)
![Western Blot BMPR-IA/ALK-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/BMPR-IA_AF346_Western_Blot_9327.jpg)
![Immunohistochemistry BMPR-IA/ALK-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af346_human-bmpr-ia-alk-3-affinity-purified-polyclonal-ab-immunohistochemistry-35202018211.jpg)
![Immunohistochemistry GDF-5/BMP-14 Antibody [Unconjugated]](https://images.novusbio.com/images2/GDF-5_AF853_Immunohistochemistry_6908.jpg)
![Western Blot GDF-5/BMP-14 Antibody [Unconjugated]](https://images.novusbio.com/images2/af853_mouse-gdf-5-affinity-purified-polyclonal-ab-western-blot-25102022133916.jpg)
![SDS-PAGE BMP-9 [Unconjugated]](https://images.novusbio.com/images2/BMP-9_3209-BP_CF_568.jpg)
![Bioactivity BMP-9 [Unconjugated]](https://images.novusbio.com/images2/BMP-9_3209-BP_CF_618.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")