Home » BCOR » BCOR Proteins » BCOR Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

BCOR Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BCOR Recombinant Protein Antigen (NBP2-58057PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BCOR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCOR.

Source: E. coli

Amino Acid Sequence: NINGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58057.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BCOR Recombinant Protein Antigen

  • ANOP2
  • BCL6 corepressor
  • BCL-6 corepressor
  • BCL6 co-repressor
  • BCL-6 interacting corepressor
  • BCoR
  • FLJ20285
  • FLJ38041
  • KIAA1575MGC71031
  • MAA2
  • MCOPS2
  • MGC131961

Background

BCOR is encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl-6 Antibody
NBP2-59786
Immunocytochemistry/ Immunofluorescence Bcl-6 Antibody
Immunohistochemistry-Paraffin Bcl-6 Antibody
Immunohistochemistry-Paraffin Bcl-6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NCOR2 Antibody
NB120-5802
Immunocytochemistry/ Immunofluorescence NCOR2 Antibody
Immunocytochemistry/ Immunofluorescence NCOR2 Antibody
Immunocytochemistry/ Immunofluorescence NCOR2 Antibody
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
AF9 Antibody
NBP2-15303
Immunocytochemistry/ Immunofluorescence AF9 Antibody
Western Blot AF9 Antibody
Immunohistochemistry-Paraffin AF9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
KDM2B Antibody
(5G1)
H00084678-M09
Western Blot KDM2B Antibody (5G1)
Sandwich ELISA KDM2B Antibody (5G1)
Immunocytochemistry/ Immunofluorescence KDM2B Antibody (5G1)
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
RNF2 Antibody (6C2)
H00006045-M01
Western Blot RNF2 Antibody (6C2)
Western Blot RNF2 Antibody (6C2)
Sandwich ELISA RNF2 Antibody (6C2)
(4 Publications)
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Western Blot NPM1 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
PCGF1 Antibody
NBP1-82767
Immunohistochemistry-Paraffin PCGF1 Antibody
Immunohistochemistry-Paraffin PCGF1 Antibody
Immunohistochemistry-Paraffin PCGF1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/ Immunofluorescence RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
NCOR1 Antibody
(7A7A9) - BSA Free
NBP1-28863
Immunohistochemistry-Paraffin NCOR1 Antibody (7A7A9) - BSA Free
Immunohistochemistry NCOR1 Antibody (7A7A9) - BSA Free
Western Blot NCOR1 Antibody (7A7A9) - BSA Free
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PLZF Antibody
[Unconjugated]
AF2944
Western Blot PLZF Antibody [Unconjugated]
Simple Western PLZF Antibody [Unconjugated]
Western Blot PLZF Antibody [Unconjugated]
(45 Publications)
Species: Hu
Applications: Simple Western, WB
CCNB3 Antibody
NBP1-89475
Immunocytochemistry/ Immunofluorescence CCNB3 Antibody
Immunohistochemistry-Paraffin CCNB3 Antibody
Immunohistochemistry-Paraffin CCNB3 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RING1 Antibody
NBP1-80830
Immunocytochemistry/ Immunofluorescence RING1 Antibody
Western Blot RING1 Antibody
Immunohistochemistry-Paraffin RING1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RYBP/DEDAF
Antibody (OTI1B2)
NBP2-02009
Western Blot RYBP/DEDAF Antibody (OTI1B2)
Immunohistochemistry-Paraffin RYBP/DEDAF Antibody (OTI1B2)
Immunohistochemistry-Paraffin RYBP/DEDAF Antibody (OTI1B2)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(525 Publications)
Species: Hu
Applications: BA, BA
TBX1 Antibody
(OTI1C2)
NBP2-46076
Western Blot TBX1 Antibody (OTI1C2)
Immunohistochemistry-Paraffin TBX1 Antibody (OTI1C2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(202 Publications)
Species: Hu
Applications: BA

Publications for BCOR Recombinant Protein Antigen (NBP2-58057PEP) (0)

There are no publications for BCOR Recombinant Protein Antigen (NBP2-58057PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCOR Recombinant Protein Antigen (NBP2-58057PEP) (0)

There are no reviews for BCOR Recombinant Protein Antigen (NBP2-58057PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BCOR Recombinant Protein Antigen (NBP2-58057PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCOR Products

Blogs on BCOR

There are no specific blogs for BCOR, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BCOR Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BCOR