![Immunohistochemistry-Paraffin: ATPB Antibody (9A1O2) [NBP3-15354] - Immunohistochemistry of paraffin-embedded human esophageal cancer using ATPB Rabbit mAb (NBP3-15354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ATPB-Antibody-9A1O2-Immunohistochemistry-Paraffin-NBP3-15354-img0002.jpg "Immunohistochemistry-Paraffin: ATPB Antibody (9A1O2) [NBP3-15354] - Immunohistochemistry of paraffin-embedded human esophageal cancer using ATPB Rabbit mAb (NBP3-15354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 1H2W2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-529 of human ATPB (NP_001677.2). YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | ATP5F1B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATPB Antibody (NBP3-15354)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATP5F1B |
![Immunohistochemistry-Paraffin: ATPB Antibody (9A1O2) [NBP3-15354] - Immunohistochemistry of paraffin-embedded rat kidney using ATPB Rabbit mAb (NBP3-15354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ATPB-Antibody-9A1O2-Immunohistochemistry-Paraffin-NBP3-15354-img0001.jpg "Immunohistochemistry-Paraffin: ATPB Antibody (9A1O2) [NBP3-15354] - Immunohistochemistry of paraffin-embedded rat kidney using ATPB Rabbit mAb (NBP3-15354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: ATPB Antibody (9A1O2) [NBP3-15354] - analysis of extracts of various cell lines, using ATPB antibody at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-15354_rabbit-atpb-mab-9a1o2-western-blot-510202312496..jpg "Western Blot: ATPB Antibody (9A1O2) [NBP3-15354] - analysis of extracts of various cell lines, using ATPB antibody at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunocytochemistry/Immunofluorescence: ATPB Antibody (9A1O2) [NBP3-15354] - HepG2 cells using ATPB Rabbit mAb (dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.](http://images.novusbio.com/fullsize/nbp3-15354_rabbit-atpb-mab-9a1o2-immunocytochemistry-immunofluorescence-5102023125019..jpg "Immunocytochemistry/Immunofluorescence: ATPB Antibody (9A1O2) [NBP3-15354] - HepG2 cells using ATPB Rabbit mAb (dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")