![Immunocytochemistry/Immunofluorescence: TIAL1 Antibody [NBP1-79932] - Immunofluorescence analyses of TIAL1 (h) against cytoplasmic opTDP-43h and opTDP-43hA315T aggregates at 120hpf. At least, twenty cells with distinct opTDP-43h or opTDP-43hA315T aggregates were examined for each of three independent fish. *p<0.0001, **p<0.0001, ***p=0.03 (unpaired t-test, two-tailed). The bars ndicate 5um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-020-14815-x), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TIAL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-79932-img0005.jpg "Immunocytochemistry/Immunofluorescence: TIAL1 Antibody [NBP1-79932] - Immunofluorescence analyses of TIAL1 (h) against cytoplasmic opTDP-43h and opTDP-43hA315T aggregates at 120hpf. At least, twenty cells with distinct opTDP-43h or opTDP-43hA315T aggregates were examined for each of three independent fish. *p<0.0001, **p<0.0001, ***p=0.03 (unpaired t-test, two-tailed). The bars ndicate 5um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-020-14815-x), licensed under a CC-BY license.")
| Reactivity | Hu, ZeSpecies Glossary |
| Applications | WB, Func, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TIAL1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 29975683). Use in In-situ Hybridization reported in scientific literature (PMID: 27489304). |
|
| Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TIAL1 Antibody (NBP1-79932)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TIAL1 Antibody [NBP1-79932] - Host: Rabbit. Target: TIAL1. Positive control (+): Mouse Spleen (M-SP). Negative control (-): Mouse Liver (M-LI). Antibody concentration: 2ug/ml](http://images.novusbio.com/fullsize/TIAL1-Antibody-Western-Blot-NBP1-79932-img0004.jpg "Western Blot: TIAL1 Antibody [NBP1-79932] - Host: Rabbit. Target: TIAL1. Positive control (+): Mouse Spleen (M-SP). Negative control (-): Mouse Liver (M-LI). Antibody concentration: 2ug/ml")
![Western Blot: TIAL1 Antibody [NBP1-79932] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.](http://images.novusbio.com/fullsize/TIAL1-Antibody-Western-Blot-NBP1-79932-img0003.jpg "Western Blot: TIAL1 Antibody [NBP1-79932] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.")
![Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932] - rbpms2 mutant allele stability & localization activity in somatic cells.(A) RT-PCR to detect rbpms2a & rbpms2b maternal transcripts. Pink asterisks indicate likely nonsense mediated decay of mutant allele transcripts. (B-F) Wild-type GFP-Rbpms2a/b (B, D) & GFP-Rbpms2bsa9329 (F) localize to granules in HEK 293 cells, while GFP-Rbpms2aae30 & GFP-Rbpms2bae32 are not localized. (G-K) Zebrafish blastula cells expressing GFP-Rbpms2 fusions. (G,H) Wild-type GFP-Rbpms2b localizes near the nucleus (H), is apparently associated with the centrosome/spindle in some cells, & (G) is in granules that are not positive for the stress granule marker Tial-1. (H) A subset of GFP-Rbpms2b positive granules are positive for the p-body marker Dcp2 (open arrowheads). (I) GFP-Rbpms2bsa9329 localization to the centrosome/spindle but not granules. (J) GFP-Rbpms2bae32 & (K) GFP-Rbpms2aae30 localization. Insets show magnified views of the highlighted cells. Images are representative slices from Z-stacks of sphere stage embryos viewed from the animal pole. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29975683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-79932_rabbit-polyclonal-tial1-antibody-31020241616013.jpg "Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [NBP1-79932] - rbpms2 mutant allele stability & localization activity in somatic cells.(A) RT-PCR to detect rbpms2a & rbpms2b maternal transcripts. Pink asterisks indicate likely nonsense mediated decay of mutant allele transcripts. (B-F) Wild-type GFP-Rbpms2a/b (B, D) & GFP-Rbpms2bsa9329 (F) localize to granules in HEK 293 cells, while GFP-Rbpms2aae30 & GFP-Rbpms2bae32 are not localized. (G-K) Zebrafish blastula cells expressing GFP-Rbpms2 fusions. (G,H) Wild-type GFP-Rbpms2b localizes near the nucleus (H), is apparently associated with the centrosome/spindle in some cells, & (G) is in granules that are not positive for the stress granule marker Tial-1. (H) A subset of GFP-Rbpms2b positive granules are positive for the p-body marker Dcp2 (open arrowheads). (I) GFP-Rbpms2bsa9329 localization to the centrosome/spindle but not granules. (J) GFP-Rbpms2bae32 & (K) GFP-Rbpms2aae30 localization. Insets show magnified views of the highlighted cells. Images are representative slices from Z-stacks of sphere stage embryos viewed from the animal pole. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29975683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A ADAMTS13 [HRP]](https://images.novusbio.com/images2/ADAMTS13_DADT130_ELISA_24.jpg)
![N/A ADAMTS13 [HRP]](https://images.novusbio.com/images2/DATA_ADAMTS13_DADT130_ELISA_565.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")