Home » Cyclin I » Cyclin I Antibodies » Cyclin I Antibody
Novus Biologicals products are now on bio-techne.com

Cyclin I Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: Cyclin I Antibody [NBP2-34060] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunocytochemistry/ Immunofluorescence: Cyclin I Antibody [NBP2-34060] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry: Cyclin I Antibody [NBP2-34060] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Cyclin I Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNV
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cyclin I Protein (NBP2-34060PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cyclin I Antibody

  • CYC1
  • cyclin I
  • cyclin ITI
  • cyclin-I
  • CYI

Background

The protein encoded by the Cyclin gene belongs to the highly conserved cyclin family, whose members are characterized by adramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases.Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordinationof each mitotic event. This cyclin shows the highest similarity with cyclin G. The transcript of this gene was foundto be expressed constantly during cell cycle progression. The function of this cyclin has not yet been determined.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
HAP1 Antibody (1B6)
NB110-74569
Immunohistochemistry HAP1 Antibody (1B6)
Western Blot HAP1 Antibody (1B6)
Western Blot HAP1 Antibody (1B6)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Galanin Antibody
NBP2-33582
Immunocytochemistry/ Immunofluorescence Galanin Antibody
Immunohistochemistry-Paraffin Galanin Antibody
Immunohistochemistry-Paraffin Galanin Antibody
(1 Review)
(2 Publications)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Recombinant Human
TATA binding protein ...
H00006908-Q01
SDS-PAGE Recombinant Human TATA binding protein TBP GST (N-Term) Protein
(5 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Galectin-4
Antibody [Unconjugate
AF2128
Immunohistochemistry Galectin-4 Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: IHC, WB
Galectin-1
Antibody [Unconjugate
AF1152
Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]
Simple Western Galectin-1 Antibody [Unconjugated]
Immunohistochemistry Galectin-1 Antibody [Unconjugated]
(4 Reviews)
(22 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NFYA Antibody
NBP2-19533
Immunocytochemistry/ Immunofluorescence NFYA Antibody
Western Blot NFYA Antibody
Western Blot NFYA Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Galectin-10
Antibody [Unconjugate
AF5447
Western Blot Galectin-10 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
alcohol
dehydrogenase Antibod
NBP3-35880
Western Blot alcohol dehydrogenase Antibody
Immunocytochemistry/ Immunofluorescence alcohol dehydrogenase Antibody
Immunocytochemistry/ Immunofluorescence alcohol dehydrogenase Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
GCET2 Antibody
NBP1-82693
Western Blot GCET2 Antibody
Immunohistochemistry-Paraffin GCET2 Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Cdk5 Antibody
NBP2-15843
Western Blot Cdk5 Antibody
Immunohistochemistry-Paraffin Cdk5 Antibody
Immunocytochemistry/ Immunofluorescence Cdk5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Recombinant Human
CYP27B1 GST (N-Term) ...
H00001594-Q01
Other Recombinant Human CYP27B1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Cytochrome P450
1A1/1A2 Antibody (MC1
NB100-74398
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
(1 Review)
(2 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TFIIB Antibody
NBP3-35718
Immunohistochemistry TFIIB Antibody
Immunohistochemistry TFIIB Antibody
Immunohistochemistry TFIIB Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NFYB Antibody
NBP2-19535
Immunocytochemistry/ Immunofluorescence NFYB Antibody
Immunoprecipitation NFYB Antibody
Immunohistochemistry-Paraffin NFYB Antibody
Species: Hu, Mu, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/ Immunofluorescence CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Cyclin I Antibody (NBP2-34060) (0)

There are no publications for Cyclin I Antibody (NBP2-34060).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin I Antibody (NBP2-34060) (0)

There are no reviews for Cyclin I Antibody (NBP2-34060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cyclin I Antibody (NBP2-34060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin I Products

Research Areas for Cyclin I Antibody (NBP2-34060)

Find related products by research area.

Blogs on Cyclin I

There are no specific blogs for Cyclin I, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin I Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CCNI
Uniprot