![Western Blot: ASC1 Antibody [NBP3-35533] - Western blot analysis of various lysates using ASC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-35533_rabbit-asc1-pab-101220241139294.jpg "Western Blot: ASC1 Antibody [NBP3-35533] - Western blot analysis of various lysates using ASC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 282-581 of human ASC1 (NP_057297.2). Sequence: VIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLAEYHSRLDETIQAIANGTLNQPLTKLDRSSEEPLGVLVNPNMYQSPPQWVDHTGAASQKKAFRSSGFGLEFNSFQHQLRIQDQEFQEGFDGGWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIP4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 66 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ASC1 Antibody (NBP3-35533)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRIP4 |
![Immunoprecipitation: ASC1 Antibody [NBP3-35533] - Immunoprecipitation analysis of 200 ug extracts of A-549 cells using 3 ug ASC1 antibody. Western blot was performed from the immunoprecipitate using ASC1 antibody at a dilution of 1:1000.](http://images.novusbio.com/fullsize/nbp3-35533_rabbit-asc1-pab-1012202411392973.jpg "Immunoprecipitation: ASC1 Antibody [NBP3-35533] - Immunoprecipitation analysis of 200 ug extracts of A-549 cells using 3 ug ASC1 antibody. Western blot was performed from the immunoprecipitate using ASC1 antibody at a dilution of 1:1000.")
![Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35533_rabbit-asc1-pab-1012202411343334.jpg "Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35533_rabbit-asc1-pab-101220241143340.jpg "Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35533_rabbit-asc1-pab-1012202411421060.jpg "Immunohistochemistry: ASC1 Antibody [NBP3-35533] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using ASC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Western Blot RACK1/GNB2L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RACK1_AF3434_Western_Blot_5298.jpg)
![Immunocytochemistry RACK1/GNB2L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RACK1_AF3434_Immunocytochemistry__Immunofluorescence_19362.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot WNK1 Antibody [Unconjugated]](https://images.novusbio.com/images2/WNK1_AF2849_Western_Blot_5218.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunocytochemistry_11323.jpg)
![Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin-1_MAB4364_Immunohistochemistry_7025.jpg)
![Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]](https://images.novusbio.com/images2/Synaptotagmin1_MAB4364_Immunocytochemistry_13008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")