![Western Blot: ARHGEF1 Antibody [NBP1-82843] - Analysis using Anti-ARHGEF1 antibody NBP1-82843 (A) shows similar pattern to independent antibody NBP2-56320 (B).](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Western-Blot-NBP1-82843-img0015.jpg "Western Blot: ARHGEF1 Antibody [NBP1-82843] - Analysis using Anti-ARHGEF1 antibody NBP1-82843 (A) shows similar pattern to independent antibody NBP2-56320 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARHGEF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-82843 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ARHGEF1 Antibody (NBP1-82843)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ARHGEF1 Antibody [NBP1-82843] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82843-img0011.jpg "Immunocytochemistry/Immunofluorescence: ARHGEF1 Antibody [NBP1-82843] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.")
![Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Analysis in human lymph node and liver tissues using NBP1-82843 antibody. Corresponding ARHGEF1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-82843-img0014.jpg "Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Analysis in human lymph node and liver tissues using NBP1-82843 antibody. Corresponding ARHGEF1 RNA-seq data are presented for the same tissues.")
![Western Blot: ARHGEF1 Antibody [NBP1-82843] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Western-Blot-NBP1-82843-img0012.jpg "Western Blot: ARHGEF1 Antibody [NBP1-82843] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: ARHGEF1 Antibody [NBP1-82843] - Analysis using Anti-ARHGEF1 antibody NBP1-82843 (A) shows similar pattern to independent antibody NBP2-56320 (B).](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Western-Blot-NBP1-82843-img0013.jpg "Western Blot: ARHGEF1 Antibody [NBP1-82843] - Analysis using Anti-ARHGEF1 antibody NBP1-82843 (A) shows similar pattern to independent antibody NBP2-56320 (B).")
![Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-82843-img0008.jpg "Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/ARHGEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-82843-img0009.jpg "Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human lymph node shows high expression.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")