![Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Analysis in human kidney and colon tissues. Corresponding AQP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aquaporin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-33472-img0007.jpg "Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Analysis in human kidney and colon tissues. Corresponding AQP2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL |
| Predicted Species | Mouse (91%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AQP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Aquaporin-2 Antibody (NBP2-33472)Find related products by research area.
|
|
Hsc70 - a chaperone protein with diverse cellular functions Heat shock cognate 71 kDa protein (Hsc70), also known as HSPA8, is a member of the heat shock protein 70 family (Hsp70). Unlike Hsp70, it is a constitutively expressed chaperone protein and is involved in diverse cellular processes including protei... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human prostate shows no positivity in as expected.](http://images.novusbio.com/fullsize/Aquaporin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-33472-img0003.jpg "Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human prostate shows no positivity in as expected.")
![Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Aquaporin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-33472-img0004.jpg "Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human colon shows no cytoplasmic positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Aquaporin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-33472-img0005.jpg "Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human colon shows no cytoplasmic positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human kidney shows moderate positivity in luminal membrane in cells in tubules.](http://images.novusbio.com/fullsize/Aquaporin-2-Antibody-Immunohistochemistry-Paraffin-NBP2-33472-img0006.jpg "Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NBP2-33472] - Staining of human kidney shows moderate positivity in luminal membrane in cells in tubules.")
![Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af245_mouse-tsp50-affinity-purified-polyclonal-ab-western-blot-672022104711.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")