Home » APBB3 » APBB3 Antibodies » APBB3 Antibody
Novus Biologicals products are now on bio-techne.com

APBB3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: APBB3 Antibody [NBP3-10783] - Western blot analysis of APBB3 in Human 293T Whole Cell. Antibody dilution at 1 ug/mL
Western Blot: APBB3 Antibody [NBP3-10783] - Western blot analysis of APBB3 in Human 293T Whole Cell. Antibody dilution at 1 ug/mL

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

APBB3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human APBB3. Peptide sequence AQTRSRSQPPDGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRV
Clonality
Polyclonal
Host
Rabbit
Gene
APBB3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for APBB3 Antibody

  • amyloid beta (A4) precursor protein-binding, family B, member 3
  • amyloid precursor interacting protein
  • Fe65L2
  • FE65L2amyloid beta A4 precursor protein-binding family B member 3
  • FE65-like protein 2
  • MGC150555
  • MGC87674
  • Protein Fe65-like 2
  • SRA

Background

APBB3 is encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CXCL4/PF4 [Biotin]
DY795
N/A CXCL4/PF4 [Biotin]
(26 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
UHRF1 Antibody
NBP2-20807
Immunoprecipitation UHRF1 Antibody
Chromatin Immunoprecipitation UHRF1 Antibody
Immunohistochemistry-Paraffin UHRF1 Antibody
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(130 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
SRA1 Antibody
(1D4H8) - BSA Free
NBP1-51531
Western Blot SRA1 Antibody (1D4H8) - BSA Free
Immunohistochemistry-Paraffin SRA1 Antibody (1D4H8) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
SR-AI/MSR Antibody
- BSA Free
NBP1-00092
Flow Cytometry SR-AI/MSR Antibody - BSA Free
Immunohistochemistry-Frozen SR-AI/MSR Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SR-AI/MSR Antibody - BSA Free
(2 Reviews)
(8 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PLA, WB
FE65 Antibody -
BSA Free
NB110-58360
Western Blot FE65 Antibody - BSA Free
Western Blot FE65 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IP, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
SRC1 Antibody
(1135)
NB200-310
Western Blot SRC1 Antibody (1135)
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NCOA2 Antibody
NB100-1756
Immunohistochemistry NCOA2 Antibody
Immunocytochemistry/ Immunofluorescence NCOA2 Antibody
Immunocytochemistry/ Immunofluorescence NCOA2 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(141 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot NCOA3/AIB1 Antibody
Western Blot NCOA3/AIB1 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
Apolipoprotein L1
Antibody
NBP1-89033
Immunohistochemistry-Paraffin Apolipoprotein L1 Antibody
Immunohistochemistry-Paraffin Apolipoprotein L1 Antibody
Western Blot Apolipoprotein L1 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
CYFIP1 Antibody
NBP2-16060
Immunocytochemistry/ Immunofluorescence CYFIP1 Antibody
Western Blot CYFIP1 Antibody
Western Blot CYFIP1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
APBB2 Antibody
NBP1-84700
Western Blot APBB2 Antibody
Western Blot APBB2 Antibody
Immunohistochemistry-Paraffin APBB2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB

Publications for APBB3 Antibody (NBP3-10783) (0)

There are no publications for APBB3 Antibody (NBP3-10783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APBB3 Antibody (NBP3-10783) (0)

There are no reviews for APBB3 Antibody (NBP3-10783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APBB3 Antibody (NBP3-10783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APBB3 Products

Research Areas for APBB3 Antibody (NBP3-10783)

Find related products by research area.

Blogs on APBB3

There are no specific blogs for APBB3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APBB3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol APBB3