I am looking to use a placental alkaline phosphatase antibody for sorting syncytiotrophoblast material from female tissue. It looks like most people who use these antibodies use in-house versions and references for commercially available antibodies I've found are from the '80's. I noticed you have several different monoclonal antibodies and was hoping you could give me a little more information on them and potential applications they've been tested for. Also, do you have a biotinylated or fluorophore-conjugated version?

Name: Alkaline Phosphatase/ALPP Antibody
Brand: Novus Biologicals
SKU: NBP1-57907
Price: 399 USD

Question

Accepted Answer

None of our placental alkaline phosphatase antibodies are biotinylated or fluorchrome conjugated but we offer a number of kits for this application and our lab can do a custom conjugation as well, for an additional fee. NB600-750 is useful in FACS with human cells, so I would recommend this antibody for your experiment. We back the use of this antibody as stated on the datasheet with the 100% Novus Guarantee. If you have questions about another antibody, I will be happy to answer them.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	1 mg/ml

Description	The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen	Synthetic peptides corresponding to ALPP(alkaline phosphatase, placental (Regan isozyme)) The peptide sequence was selected from the C terminal of ALPP (NP_001623). Peptide sequence TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA. The peptide sequence for this immunogen was taken from within the described region.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	ALPP
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS, 2% Sucrose
Preservative	0.09% Sodium Azide
Concentration	1 mg/ml
Purity	Protein A purified

Gene Symbol	ALPP
Entrez	250 (Human)
Uniprot	P05187()

Alkaline Phosphatase/ALPP Antibody

Species Glossary

Images

Product Details

Order Details

Alkaline Phosphatase/ALPP Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Alkaline Phosphatase/ALPP Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Alkaline Phosphatase/ALPP Antibody (NBP1-57907)(1)

Reviews for Alkaline Phosphatase/ALPP Antibody (NBP1-57907) (0)

Product General Protocols

Video Protocols

FAQs for Alkaline Phosphatase/ALPP Antibody (NBP1-57907). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional Alkaline Phosphatase/ALPP Products

Research Areas for Alkaline Phosphatase/ALPP Antibody (NBP1-57907)

Blogs on Alkaline Phosphatase/ALPP

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics