Home » ALDH8A1 » ALDH8A1 Proteins » ALDH8A1 Recombinant Protein Antigen

ALDH8A1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ALDH8A1 Protein (NBP2-38753PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ALDH8A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH8A1.

Source: E. coli

Amino Acid Sequence: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH8A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38753.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ALDH8A1 Recombinant Protein Antigen

  • Aldehyde dehydrogenase 12
  • aldehyde dehydrogenase 8 family, member A1
  • aldehyde dehydrogenase family protein
  • ALDH12aldehyde dehydrogenase family 8 member A1
  • DJ352A20.2
  • DKFZp779D2315
  • EC 1.2.1
  • EC 1.2.1.-
  • EC 1.2.1.3
  • MGC138650

Background

ALDH8A1 belongs to the aldehyde dehydrogenases family of proteins. It plays a role in a pathway of 9-cis-retinoic acid biosynthesis in vivo. This enzyme converts 9-cis-retinal into the retinoid X receptor ligand 9-cis-retinoic acid, and has approximately 40-fold higher activity with 9-cis-retinal than with all-trans-retinal. Therefore, it is the first known aldehyde dehydrogenase to show a preference for 9-cis-retinal relative to all-trans-retinal. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Aldehyde
Dehydrogenase 1-A1/AL ...
AF5869
Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]
Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]
Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]
(10 Publications)
Species: Hu, Mu
Applications: ICC, IHC, IP, Simple Western, WB
ALDH1A2 Antibody
NBP1-87158
Immunohistochemistry-Paraffin ALDH1A2 Antibody
Immunohistochemistry-Paraffin ALDH1A2 Antibody
Immunohistochemistry-Paraffin ALDH1A2 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AHI1 Antibody
NBP2-15309
Immunocytochemistry/ Immunofluorescence AHI1 Antibody
Immunohistochemistry-Paraffin AHI1 Antibody
Western Blot AHI1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CYP26A1 Antibody
(1E1D2)
NBP3-16627
Immunohistochemistry-Paraffin CYP26A1 Antibody (1E1D2)
Immunocytochemistry/ Immunofluorescence CYP26A1 Antibody (1E1D2)
Immunocytochemistry/ Immunofluorescence CYP26A1 Antibody (1E1D2)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PDE7B Antibody
NBP1-85987
Immunocytochemistry/ Immunofluorescence PDE7B Antibody
Western Blot PDE7B Antibody
Immunohistochemistry-Paraffin PDE7B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HBS1L Antibody
NBP1-85123
Western Blot HBS1L Antibody
Immunocytochemistry/ Immunofluorescence HBS1L Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, KD, WB
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Immunohistochemistry-Paraffin HNF-4 alpha/NR2A1 Antibody
Western Blot HNF-4 alpha/NR2A1 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FBXO7 Antibody
H00025793-B01P
Immunocytochemistry/ Immunofluorescence FBXO7 Antibody
Immunohistochemistry-Paraffin FBXO7 Antibody
Western Blot FBXO7 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
c-Myb Antibody
NBP1-80306
Western Blot c-Myb Antibody
Immunohistochemistry-Paraffin c-Myb Antibody
Western Blot c-Myb Antibody
(1 Review)
(2 Publications)
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Hemoglobin beta
Antibody
NBP2-14081
Immunocytochemistry/ Immunofluorescence Hemoglobin beta Antibody
Immunohistochemistry-Paraffin Hemoglobin beta Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(38 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
ALDH1A3 Antibody -
BSA Free
NBP2-15339
Western Blot ALDH1A3 Antibody - BSA Free
Immunohistochemistry-Frozen ALDH1A3 Antibody - BSA Free
Western Blot ALDH1A3 Antibody - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
HTRA/Protease Do
1670-SE
HTRA/Protease Do
Species: Ec
Applications: EnzAct
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
CDT1 Antibody
NB100-2567
Western Blot CDT1 Antibody
Western Blot CDT1 Antibody
Immunohistochemistry-Paraffin CDT1 Antibody
(3 Reviews)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Spectrin alpha 1
Antibody
NBP3-36712
Western Blot Spectrin alpha 1 Antibody
Immunohistochemistry Spectrin alpha 1 Antibody
Immunohistochemistry Spectrin alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for ALDH8A1 Protein (NBP2-38753PEP) (0)

There are no publications for ALDH8A1 Protein (NBP2-38753PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH8A1 Protein (NBP2-38753PEP) (0)

There are no reviews for ALDH8A1 Protein (NBP2-38753PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALDH8A1 Protein (NBP2-38753PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH8A1 Products

Blogs on ALDH8A1

There are no specific blogs for ALDH8A1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: ALDH1A3 Antibody - BSA Free [NBP2-15339] - IL25 Deficiency Induced loss of CRC stemness. The expression levels of CSC markers, namely, DCLK1, ALDH1 (NBP2-15339), and CD44, were examined in tumor tissues by Western blotting. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35359953/) licensed under a CC-BY license.
ALDH1A3 Antibody - BSA Free
NBP2-15339

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALDH8A1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ALDH8A1