![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Analysis in human liver and lymph node tissues using NBP2-55574 antibody. Corresponding ALDH1L1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP2-55574-img0012.jpg "Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Analysis in human liver and lymph node tissues using NBP2-55574 antibody. Corresponding ALDH1L1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALDH1L1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ALDH1L1 Antibody (NBP2-55574)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALDH1L1 |
![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ALDH1L1 antibody NBP2-55574 (A) shows similar protein distribution across tissues to independent antibody NBP1-89414 (B).](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP2-55574-img0011.jpg "Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-ALDH1L1 antibody NBP2-55574 (A) shows similar protein distribution across tissues to independent antibody NBP1-89414 (B).")
![Immunocytochemistry/Immunofluorescence: ALDH1L1 Antibody [NBP2-55574] - Staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55574-img0001.jpg "Immunocytochemistry/Immunofluorescence: ALDH1L1 Antibody [NBP2-55574] - Staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP2-55574-img0015.jpg "Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.")
![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP2-55574-img0013.jpg "Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP2-55574-img0014.jpg "Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human lymph node shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP2-55574-img0016.jpg "Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP2-55574] - Staining of human lymph node shows no positivity in germinal center cells as expected.")
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")