![Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining in human prostate and skeletal muscle tissues using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunohistochemistry-Paraffin-NBP1-91657-img0014.jpg "Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining in human prostate and skeletal muscle tissues using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALDH1A3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Theoretical MW | 56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Mouse | 08/07/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ALDH1A3 Antibody (NBP1-91657)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ALDH1A3 Antibody [NBP1-91657] - Analysis in human cell lines A-431 and Caco-2 using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Western-Blot-NBP1-91657-img0016.jpg "Western Blot: ALDH1A3 Antibody [NBP1-91657] - Analysis in human cell lines A-431 and Caco-2 using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.")
![Immunocytochemistry/Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91657-img0006.jpg "Immunocytochemistry/Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human skeletal muscle shows no positivity in myocytes.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunohistochemistry-NBP1-91657-img0022.jpg "Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human skeletal muscle shows no positivity in myocytes.")
![Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human prostate shows high expression.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunohistochemistry-Paraffin-NBP1-91657-img0012.jpg "Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human prostate shows high expression.")
![Immunohistochemistry-Frozen: ALDH1A3 Antibody [NBP1-91657] - Aldh1a3 expression on E11.5 mouse embryo eye. Heat induced antigen retrieval at pH 6.0 was done for 20 minutes with mouse E11.5 coronal cryosection. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunohistochemistry-Frozen-NBP1-91657-img0017.jpg "Immunohistochemistry-Frozen: ALDH1A3 Antibody [NBP1-91657] - Aldh1a3 expression on E11.5 mouse embryo eye. Heat induced antigen retrieval at pH 6.0 was done for 20 minutes with mouse E11.5 coronal cryosection. Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunohistochemistry-Paraffin-NBP1-91657-img0019.jpg "Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ALDH1A3-Antibody-Immunohistochemistry-Paraffin-NBP1-91657-img0020.jpg "Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Cell proliferation during the oestrus cycle.(a) Protocol: adult (≥10-week-old) C57Bl6/J mice were administered CldU during pro-oestrus/early oestrus (blue arrows) & then IdU at metoestrus (red arrows) to detect sequential proliferation within the mammary gland. Immunofluorescent staining of adult mammary glands stained with CldU & IdU (b), & with ER, Aldh1a3 or K5 (c). Arrows indicate CldU+IdU+ cells, which demonstrate sequential cell division among mammary epithelial cells during the oestrus cycle. Representative image from four independent samples. Scale bars, 20 μm. (d) Representative flow cytometry dot plot showing the incorporation of EdU by NCL cells following injection of either oestrogen & progesterone or oil. A total of six independent adult (≥10-week-old) mice were analysed (four injected with oestrogen & progesterone, two injected with oil only). (e) NCL cells from adult (≥10-week-old) mice that are either in G0/G1 versus S/G2/M stages of the cell cycle were analysed by quantitative RT–PCR for ER alpha mRNA expression relative to Gapdh mRNA. Expression is relative to that of NCL G0/G1 cells. Mean±s.e.m of five independent mice. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26511661), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-91657_rabbit-polyclonal-aldh1a3-antibody-310202416114739.jpg "Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Cell proliferation during the oestrus cycle.(a) Protocol: adult (≥10-week-old) C57Bl6/J mice were administered CldU during pro-oestrus/early oestrus (blue arrows) & then IdU at metoestrus (red arrows) to detect sequential proliferation within the mammary gland. Immunofluorescent staining of adult mammary glands stained with CldU & IdU (b), & with ER, Aldh1a3 or K5 (c). Arrows indicate CldU+IdU+ cells, which demonstrate sequential cell division among mammary epithelial cells during the oestrus cycle. Representative image from four independent samples. Scale bars, 20 μm. (d) Representative flow cytometry dot plot showing the incorporation of EdU by NCL cells following injection of either oestrogen & progesterone or oil. A total of six independent adult (≥10-week-old) mice were analysed (four injected with oestrogen & progesterone, two injected with oil only). (e) NCL cells from adult (≥10-week-old) mice that are either in G0/G1 versus S/G2/M stages of the cell cycle were analysed by quantitative RT–PCR for ER alpha mRNA expression relative to Gapdh mRNA. Expression is relative to that of NCL G0/G1 cells. Mean±s.e.m of five independent mice. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26511661), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunocytochemistry_10308.jpg)
![Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunohistochemistry_10638.jpg)
![Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1A1_AF5869_Simple_Western_17067.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
