![Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Western-Blot-NBP1-90232-img0007.jpg "Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADH7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADH7 |
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Immunohistochemistry-Paraffin-NBP1-90232-img0013.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Western-Blot-NBP1-90232-img0005.jpg "Western Blot: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining in human esophagus and pancreas tissues using anti-ADH7 antibody. Corresponding ADH7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Immunohistochemistry-Paraffin-NBP1-90232-img0010.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining in human esophagus and pancreas tissues using anti-ADH7 antibody. Corresponding ADH7 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human cerebellum shows no positivity as expected.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Immunohistochemistry-Paraffin-NBP1-90232-img0011.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human cerebellum shows no positivity as expected.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Immunohistochemistry-Paraffin-NBP1-90232-img0012.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-7-Antibody-Immunohistochemistry-Paraffin-NBP1-90232-img0014.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 7 Antibody [NBP1-90232] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunocytochemistry_10308.jpg)
![Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunohistochemistry_10638.jpg)
![Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1A1_AF5869_Simple_Western_17067.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")