Home » Afadin/AF-6 » Afadin/AF-6 Proteins » Afadin/AF-6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Afadin/AF-6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Afadin/AF-6 Protein (NBP1-90220PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Afadin/AF-6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLLT4.

Source: E. coli

Amino Acid Sequence: EAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AFDN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90220.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Afadin/AF-6 Recombinant Protein Antigen

  • AF6
  • AF-6
  • AF64
  • AFAD
  • Afadin
  • FLJ34371
  • MLLT4
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4

Background

AF6/Afadin was identified as part of a fusion with MLL (mixed lineage leukemia) in a t(6;11) genetic translocation. AF6/Afadin is also known as afadin (a splicing variant of AF6/Afadin found at adherins junction). AF6/afadin is an actin filament binding protein that binds to nectin at cadherin-based cell-cell adherens junctions and regulates cell-cell adhesion by mediating Ras signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Nectin-1/PVRL1
Antibody
AF2880
Nectin-1/PVRL1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(143 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Nectin-3/PVRL3
Antibody [Unconjugate
AF3064
Immunohistochemistry Nectin-3/PVRL3 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Rap1A/B Antibody
[Unconjugated]
AF3767
Western Blot Rap1A/B Antibody [Unconjugated]
Western Blot Rap1A/B Antibody [Unconjugated]
Immunohistochemistry Rap1A/B Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Catenin alpha 1
Antibody
NBP2-15723
Western Blot Catenin alpha 1 Antibody
Western Blot Catenin alpha 1 Antibody
Immunoprecipitation Catenin alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
TERF2IP Antibody
NB100-292
Immunohistochemistry-Paraffin TERF2IP Antibody
Immunoprecipitation TERF2IP Antibody
Western Blot TERF2IP Antibody
(22 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Rabex5 Antibody
NBP1-49938
Western Blot Rabex5 Antibody
Immunohistochemistry-Paraffin Rabex5 Antibody
Western Blot Rabex5 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
N-Cadherin
Antibody (13A9)
NBP1-48309
Flow (Intracellular) N-Cadherin Antibody (13A9)
Flow Cytometry N-Cadherin Antibody (13A9)
Immunocytochemistry/ Immunofluorescence N-Cadherin Antibody (13A9)
(2 Reviews)
(42 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
CD155/PVR Antibody
(300907) [Unconjugate ...
MAB25301
Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]
Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]
Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
ELISA Claudin-1 Antibody (1C5-D9)
Immunohistochemistry-Paraffin Claudin-1 Antibody (1C5-D9)
Immunohistochemistry-Paraffin Claudin-1 Antibody (1C5-D9)
(2 Reviews)
(26 Publications)
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
RALGDS Antibody -
Azide and BSA Free
NBP2-93790
Immunocytochemistry/ Immunofluorescence RALGDS Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence RALGDS Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin RALGDS Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF9 Antibody
NBP2-15303
Immunocytochemistry/ Immunofluorescence AF9 Antibody
Western Blot AF9 Antibody
Immunohistochemistry-Paraffin AF9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB

Publications for Afadin/AF-6 Protein (NBP1-90220PEP) (0)

There are no publications for Afadin/AF-6 Protein (NBP1-90220PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Afadin/AF-6 Protein (NBP1-90220PEP) (0)

There are no reviews for Afadin/AF-6 Protein (NBP1-90220PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Afadin/AF-6 Protein (NBP1-90220PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Afadin/AF-6 Products

Blogs on Afadin/AF-6

There are no specific blogs for Afadin/AF-6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Afadin/AF-6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AFDN