Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clone | 3U6B8 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 278-377 of human alpha-Actin-1 (ACTA1) (P68133). ETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | ACTA1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Actin Antibody (NBP3-16100)Find related products by research area.
|
Migrasomes: A Novel Vesicle Involved in Intercellular Signaling By Christina Towers, PhD What are migrasomes?A novel vesicular organelle was recently discovered in 2015 by a research group at Tsinghua University headed by Dr. Yu that is dependent on cell migration... Read full blog post. |
Considerations for Quantitative Western blotting By Jamshed Arslan, Pharm. D., PhD. Since its inception in 1979, Western blotting has undergone several developments. The use of radioactive probes was common throughout 1980s, but utilizing secondary antibodies labell... Read full blog post. |
Repurposing FDA-approved drugs to combat the rise of antibiotic resistance By Beth Melson, MSAntibiotic resistance is a global threat to public health. Widespread, inappropriate use of antibiotics, such as to treat viral infections or promote growth in livestock, has led to increased incid... Read full blog post. |
The use of Beta Actin (AC-15) as a loading control across multiple species Actin is a fundamental component of the cytoskeleton, where it has the ability to create and break down actin filament formation in response to various cell needs. Actin has six highly conserved isoforms, however beta and gamma actin are the two... Read full blog post. |
The use of actin as a loading control in research on fruiting-body development and vegetative growth in Sordaria macrospora research Sordaria macrospora is a filamentous fungus that serves as very useful system for scientific research due to a short life cycle and easy manipulation. Just like any other model organism, it is important to have an effective loading control to va... Read full blog post. |
CRISPR/Cas9: Keep your friends close, but your viruses closer "CRISPR", or clustered regularly interspaced short palindromic repeats, is an ancient bacterial mechanism that prevents the invasion of foreign pathogens to a host organism. Specifically, the CRISPR sequence has been identified as a si... Read full blog post. |
Alpha-actin/ACTA1 - A skeletal muscle isoform mutated in various myopathies Actin is an abundant cytoskeletal protein involved in a variety of cellular processes such as cell motility, cell division, and muscle contraction. Actin monomers assemble into filaments and can provide a track for transport of cargo by the molecul... Read full blog post. |
Alpha-Adducin - Assembling the cytoskeleton meshwork that underlies the plasma membrane The structure and organization of the plasma membrane is maintained by an underlying network of cytoskeletal proteins including actin and spectrin. Adducin, a member of this protein network, binds to bundles and caps actin filaments and links them... Read full blog post. |
Understanding Actin Alpha 2 Smooth Muscle Actins are extremely highly conserved structural proteins found in all eukaryotic cell cytoskeletons that govern cell structure, movement, and shape integrity. Six distinct actin isoforms, each encoded by a different gene and developmentally-regulated... Read full blog post. |
Could Laminin be Used to Treat Duchenne Muscular Dystrophy? Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ACTA1 |