![Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human gastrointestinal, kidney, liver and pancreas using Anti-ACOX1 antibody NBP1-80950 (A) shows similar protein distribution across tissues to independent antibody NBP1-80949 (B).](http://images.novusbio.com/fullsize/ACOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80950-img0009.jpg "Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human gastrointestinal, kidney, liver and pancreas using Anti-ACOX1 antibody NBP1-80950 (A) shows similar protein distribution across tissues to independent antibody NBP1-80949 (B).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGY |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACOX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Western_Blot_5882.jpg)
![Immunohistochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunohistochemistry_19616.jpg)
![Immunocytochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunocytochemistry__Immunofluorescence_19724.jpg)
| Publication using NBP1-80950 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACOX1 Antibody (NBP1-80950)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ACOX1 Antibody [NBP1-80950] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ACOX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80950-img0005.jpg "Immunocytochemistry/Immunofluorescence: ACOX1 Antibody [NBP1-80950] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human pancreas shows no positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/ACOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80950-img0012.jpg "Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human pancreas shows no positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ACOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80950-img0008.jpg "Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ACOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80950-img0010.jpg "Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-80950-img0011.jpg "Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Simple Western UCP1 Antibody (536435) [Unconjugated]](https://images.novusbio.com/images2/16325.jpg)
![Immunocytochemistry UCP1 Antibody (536435) [Unconjugated]](https://images.novusbio.com/images2/UCP1_MAB6158_Immunocytochemistry__Immunofluorescence_16926.jpg)
![Intracellular Staining by Flow Cytometry UCP1 Antibody (536435) [Unconjugated]](https://images.novusbio.com/images2/UCP1_MAB6158_Flow_Cytometry_22032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")