![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining in human parathyroid gland and pancreas tissues using anti-AAK1 antibody. Corresponding AAK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0009.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining in human parathyroid gland and pancreas tissues using anti-AAK1 antibody. Corresponding AAK1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIGKVIISVSSVMHDMCA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AAK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Western_Blot_16272.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16281.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16416.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for AAK1 Antibody (NBP1-84110)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human colon, liver, lymph node and parathyroid gland using Anti-AAK1 antibody NBP1-84110 (A) shows similar protein distribution across tissues to independent antibody NBP1-84111 (B).](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0011.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human colon, liver, lymph node and parathyroid gland using Anti-AAK1 antibody NBP1-84110 (A) shows similar protein distribution across tissues to independent antibody NBP1-84111 (B).")
![Immunocytochemistry/Immunofluorescence: AAK1 Antibody [NBP1-84110] - Staining of human cell line U-251 MG shows localization to plasma membrane.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84110-img0010.jpg "Immunocytochemistry/Immunofluorescence: AAK1 Antibody [NBP1-84110] - Staining of human cell line U-251 MG shows localization to plasma membrane.")
![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human colon.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0015.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human colon.")
![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0007.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0008.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human parathyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human liver.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0012.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human liver.")
![Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human lymph node.](http://images.novusbio.com/fullsize/AAK1-Antibody-Immunohistochemistry-Paraffin-NBP1-84110-img0014.jpg "Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human lymph node.")
![Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunocytochemistry_6471.jpg)
![Western Blot FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Western_Blot_17166.jpg)
![Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP4_AF1443_Immunohistochemistry_7312.jpg)
![Immunocytochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunocytochemistry__Immunofluorescence_21145.jpg)
![Immunohistochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunohistochemistry_12968.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")