![Western Blot: YY1 Antibody (2C4) [H00007528-M01] - YY1 monoclonal antibody (M01), clone 2C4 Analysis of YY1 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/YY1-Antibody-2C4-Western-Blot-H00007528-M01-img0016.jpg "Western Blot: YY1 Antibody (2C4) [H00007528-M01] - YY1 monoclonal antibody (M01), clone 2C4 Analysis of YY1 expression in Hela S3 NE.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 2C4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | YY1 (NP_003394, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH |
| Specificity | YY1 - YY1 transcription factor |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | YY1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for YY1 Antibody (H00007528-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: YY1 Antibody (2C4) [H00007528-M01] - Analysis of monoclonal antibody to YY1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/YY1-Antibody-2C4-Immunocytochemistry-Immunofluorescence-H00007528-M01-img0012.jpg "Immunocytochemistry/Immunofluorescence: YY1 Antibody (2C4) [H00007528-M01] - Analysis of monoclonal antibody to YY1 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: YY1 Antibody (2C4) [H00007528-M01] - Analysis of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/YY1-Antibody-2C4-Immunohistochemistry-Paraffin-H00007528-M01-img0014.jpg "Immunohistochemistry-Paraffin: YY1 Antibody (2C4) [H00007528-M01] - Analysis of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.")
![Western Blot: YY1 Antibody (2C4) [H00007528-M01] - Analysis of YY1 expression in transfected 293T cell line by YY1 monoclonal antibody (M01), clone 2C4.Lane 1: YY1 transfected lysate(44.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/YY1-Antibody-2C4-Western-Blot-H00007528-M01-img0017.jpg "Western Blot: YY1 Antibody (2C4) [H00007528-M01] - Analysis of YY1 expression in transfected 293T cell line by YY1 monoclonal antibody (M01), clone 2C4.Lane 1: YY1 transfected lysate(44.7 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: YY1 Antibody (2C4) [H00007528-M01] - Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/YY1-Antibody-2C4-Sandwich-ELISA-H00007528-M01-img0015.jpg "Sandwich ELISA: YY1 Antibody (2C4) [H00007528-M01] - Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")