WT1 Recombinant Protein Antigen

Images

 
There are currently no images for WT1 Recombinant Protein Antigen (NBP2-56086PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WT1.

Source: E. coli

Amino Acid Sequence: PHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56086.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WT1 Recombinant Protein Antigen

  • AWT1
  • GUD
  • NPHS4GUD
  • WAGR
  • Wilms tumor 1
  • Wilms tumor protein
  • WIT-2
  • WT1
  • WT33

Background

Wilms' tumor protein (WT1) is a transcription factor which regulates the expression of numerous target genes, including EPO. This protein plays an essential role in the normal development of the urogenital system, including cellular development and cell survival, and it has both tumor suppressor and oncogenic roles in tumor formation.

Defects in the WT1 protein can lead to Wilms tumor, Frasier syndrome, Denys-Drash syndrome, nephrotic syndrome type 4, and Meacham syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52823
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP1-92686
Species: Ca, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF3364
Species: Hu
Applications: ICC, IHC, WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
292-G2
Species: Hu
Applications: BA
AF3159
Species: Mu
Applications: IHC
PP-H7431-00
Species: Hu
Applications: WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
AF4117
Species: Rt
Applications: IHC, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB

Publications for WT1 Recombinant Protein Antigen (NBP2-56086PEP) (0)

There are no publications for WT1 Recombinant Protein Antigen (NBP2-56086PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WT1 Recombinant Protein Antigen (NBP2-56086PEP) (0)

There are no reviews for WT1 Recombinant Protein Antigen (NBP2-56086PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WT1 Recombinant Protein Antigen (NBP2-56086PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WT1 Products

Research Areas for WT1 Recombinant Protein Antigen (NBP2-56086PEP)

Find related products by research area.

Blogs on WT1.

Routine WT1 Antibody Screen Uncovers an Exciting New Cancer-Cleaning Enzyme
Enzyme antibodies are widely used in both apoptosis and cancer studies, as disruption of the proteins regulating apoptosis is known to lead to formation of tumor cells in certain cancers. We at Novus Biologicals are continually growing our enzyme anti...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WT1