VE-Cadherin Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VE-Cadherin Source: E.coli
Amino Acid Sequence: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
CDH5 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21223. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for VE-Cadherin Recombinant Protein Antigen
Background
VE-cadherin (cadherin-5) is an endothelial specific adhesion molecule that is essential for the maintenance of endothelial barrier function and angiogenesis. VE-cadherin is linked to the actin cytoskeleton through a number of adaptor proteins including a-, â-, and ã-catenin. Cytoskeletal dynamics and phosphorylation regulate VE-cadherin mediated cell-cell adhesion. The cytosolic C-terminal Src kinase (Csk) binds via its SH2 domain to the phosphorylated tyrosine 658 site of VE-cadherin. This interaction regulates density dependent cell proliferation. Phosphorylation of tyrosine 658 has also been shown to lead to the uncoupling of p120-catenin from the cytoplasmic tail of VE-cadherin. This phosphorylation event is sufficient to maintain cells in a mesenchymal state during the cell invasion phase of angiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: Block, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AC
Publications for VE-Cadherin Recombinant Protein Antigen (NBP3-21223PEP) (0)
There are no publications for VE-Cadherin Recombinant Protein Antigen (NBP3-21223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VE-Cadherin Recombinant Protein Antigen (NBP3-21223PEP) (0)
There are no reviews for VE-Cadherin Recombinant Protein Antigen (NBP3-21223PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for VE-Cadherin Recombinant Protein Antigen (NBP3-21223PEP) (0)