![Immunocytochemistry/Immunofluorescence: UQCRQ Antibody [NBP1-92563] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/UQCRQ-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92563-img0005.jpg "Immunocytochemistry/Immunofluorescence: UQCRQ Antibody [NBP1-92563] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRQ |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 25605331). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Immunocytochemistry_10939.jpg)
![ELISA Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_ELISA_22249.jpg)
![Western Blot Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Western_Blot_23415.jpg)
| Publication using NBP1-92563 | Applications | Species |
|---|---|---|
| Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for UQCRQ Antibody (NBP1-92563)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UQCRQ |
![Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human skin shows moderate to strong granular cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/UQCRQ-Antibody-Immunohistochemistry-Paraffin-NBP1-92563-img0009.jpg "Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human skin shows moderate to strong granular cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/UQCRQ-Antibody-Immunohistochemistry-Paraffin-NBP1-92563-img0006.jpg "Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/UQCRQ-Antibody-Immunohistochemistry-Paraffin-NBP1-92563-img0007.jpg "Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/UQCRQ-Antibody-Immunohistochemistry-Paraffin-NBP1-92563-img0008.jpg "Immunohistochemistry-Paraffin: UQCRQ Antibody [NBP1-92563] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")