![Western Blot: UQCRB Antibody [NBP1-80860] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/UQCRB-Antibody-Western-Blot-NBP1-80860-img0007.jpg "Western Blot: UQCRB Antibody [NBP1-80860] - Analysis in human cell line A-431.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 25605331). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Immunocytochemistry_10939.jpg)
![ELISA Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_ELISA_22249.jpg)
![Western Blot Granzyme A Antibody [Unconjugated]](https://images.novusbio.com/images2/Granzyme_A_AF2905_Western_Blot_23415.jpg)
| Publications using NBP1-80860 | Applications | Species |
|---|---|---|
| Nawfal Al-hashimi Investigating the Effect of the Amelogenin Peptide C11 on Differentiation of Stem Cells of the Apical Papilla (SCAP) toward an Odontoblastic Phenotype: A Pilot Study in Regenerative Endodontics Thesis 2022-01-01 (IHC-P, Human) | IHC-P | Human |
| Martin S, Mu D CRISPR-Induced Loss of Connexin 43 Expression Sensitizes KRAS Mutant Cells to Cisplatin microPublication biology 2022-11-13 [PMID: 36447529] (WB, Human) | WB | Human |
| Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for UQCRB Antibody (NBP1-80860)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: UQCRB Antibody [NBP1-80860] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/UQCRB-Antibody-Immunohistochemistry-Paraffin-NBP1-80860-img0005.jpg "Immunohistochemistry-Paraffin: UQCRB Antibody [NBP1-80860] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: UQCRB Antibody [NBP1-80860] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/UQCRB-Antibody-Western-Blot-NBP1-80860-img0008.jpg "Western Blot: UQCRB Antibody [NBP1-80860] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")