![Western Blot: COQ2 Antibody [NBP2-56780] - Analysis NBP2-56780 (A) shows similar pattern to independent antibody NBP2-49563 (B).](http://images.novusbio.com/fullsize/COQ2-Antibody-Western-Blot-NBP2-56780-img0004.jpg "Western Blot: COQ2 Antibody [NBP2-56780] - Analysis NBP2-56780 (A) shows similar pattern to independent antibody NBP2-49563 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COQ2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry Prohibitin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prohibitin_AF3470_Immunocytochemistry__Immunofluorescence_20123.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COQ2 |
![Immunocytochemistry/Immunofluorescence: COQ2 Antibody [NBP2-56780] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/COQ2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56780-img0001.jpg "Immunocytochemistry/Immunofluorescence: COQ2 Antibody [NBP2-56780] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_6775.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_10004.jpg)
![Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images/af3159_mouse-nephrin-affinity-purified-polyclonal-ab-41202410484365.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")