![Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining in human heart muscle and pancreas tissues using anti-UQCRC2 antibody. Corresponding UQCRC2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80861-img0012.jpg "Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining in human heart muscle and pancreas tissues using anti-UQCRC2 antibody. Corresponding UQCRC2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UQCRC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 48 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-80861 | Applications | Species |
|---|---|---|
| Xu W, Zhao L An Enzyme-Linked Immunosorbent Assay for the Detection of Mitochondrial DNA-Protein Cross-Links from Mammalian Cells DNA 2022-11-11 (WB, Human) | WB | Human |
| Boschann F, Sczakiel H, Zhao M et al FINCA syndrome beyond pulmonary affection: biallelic NHLRC2 variants in eight families with intellectual disability and epilepsy Research Square 2022-11-11 (WB, Human) | WB | Human |
| Moreau, M, Capallere, C, et al. Reconstruction of functional human epidermis equivalent containing 5%IPS-derived keratinocytes treated with mitochondrial stimulating plant extracts. Sci Rep [PMID: 35641783] (Simple Western, Human) Details: 0.180555556 |
Simple Western | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for UQCRC2 Antibody (NBP1-80861)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human cerebral cortex, heart muscle, liver and pancreas using Anti-UQCRC2 antibody NBP1-80861 (A) shows similar protein distribution across tissues to independent antibody NBP1-80862 (B).](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80861-img0013.jpg "Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human cerebral cortex, heart muscle, liver and pancreas using Anti-UQCRC2 antibody NBP1-80861 (A) shows similar protein distribution across tissues to independent antibody NBP1-80862 (B).")
![Western Blot: UQCRC2 Antibody [NBP1-80861] - Analysis using Anti-UQCRC2 antibody NBP1-80861 (A) shows similar pattern to independent antibody NBP1-80862 (B).](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Western-Blot-NBP1-80861-img0014.jpg "Western Blot: UQCRC2 Antibody [NBP1-80861] - Analysis using Anti-UQCRC2 antibody NBP1-80861 (A) shows similar pattern to independent antibody NBP1-80862 (B).")
![Immunocytochemistry/Immunofluorescence: UQCRC2 Antibody [NBP1-80861] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80861-img0009.jpg "Immunocytochemistry/Immunofluorescence: UQCRC2 Antibody [NBP1-80861] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80861-img0016.jpg "Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human cerebral cortex.")
![Western Blot: UQCRC2 Antibody [NBP1-80861] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Western-Blot-NBP1-80861-img0008.jpg "Western Blot: UQCRC2 Antibody [NBP1-80861] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80861-img0010.jpg "Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80861-img0011.jpg "Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human liver.](http://images.novusbio.com/fullsize/UQCRC2-Antibody-Immunohistochemistry-Paraffin-NBP1-80861-img0015.jpg "Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human liver.")
![N/A Fetuin A/AHSG [HRP]](https://images.novusbio.com/images2/DATA_Fetuin_A_DFTA00_ELISA_684.jpg)
![N/A Fetuin A/AHSG [HRP]](https://images.novusbio.com/images2/DATA_Fetuin_A_DFTA00_ELISA_685.jpg)
![N/A Fetuin A/AHSG [HRP]](https://images.novusbio.com/images2/Fetuin_A_DFTA00_ELISA_99.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")