![Western Blot: UFL1 Antibody [NBP1-90692] - Analysis using Anti-UFL1 antibody NBP1-90692 (A) shows similar pattern to independent antibody NBP1-90691 (B).](http://images.novusbio.com/fullsize/UFL1-Antibody-Western-Blot-NBP1-90692-img0021.jpg "Western Blot: UFL1 Antibody [NBP1-90692] - Analysis using Anti-UFL1 antibody NBP1-90692 (A) shows similar pattern to independent antibody NBP1-90691 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFSKQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UFL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90692 | Applications | Species |
|---|---|---|
| DeJesus R, Moretti F, McAllister G et al. Functional CRISPR screening identifies the ufmylation pathway as a regulator of SQSTM1/p62. Elife 2016-06-28 [PMID: 27351204] (KO, Human) | KO | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
lachaud christophe |
WB | Human | 05/13/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UFL1 |
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human kidney, skeletal muscle, stomach and testis using Anti-UFL1 antibody NBP1-90692 (A) shows similar protein distribution across tissues to independent antibody NBP1-90691 (B).](http://images.novusbio.com/fullsize/UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0022.jpg "Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human kidney, skeletal muscle, stomach and testis using Anti-UFL1 antibody NBP1-90692 (A) shows similar protein distribution across tissues to independent antibody NBP1-90691 (B).")
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human kidney shows very weak cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0026.jpg "Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human kidney shows very weak cytoplasmic positivity in cells in tubules.")
![Western Blot: UFL1 Antibody [NBP1-90692] - Analysis in human cell line Daudi.](http://images.novusbio.com/fullsize/UFL1-Antibody-Western-Blot-NBP1-90692-img0017.jpg "Western Blot: UFL1 Antibody [NBP1-90692] - Analysis in human cell line Daudi.")
![Western Blot: UFL1 Antibody [NBP1-90692] - HeLa cell lysate (35 ug each lane). Image from verified customer review.](http://images.novusbio.com/fullsize/UFL1-Antibody-Western-Blot-NBP1-90692-img0020.jpg "Western Blot: UFL1 Antibody [NBP1-90692] - HeLa cell lysate (35 ug each lane). Image from verified customer review.")
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0023.jpg "Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human stomach shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0024.jpg "Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human stomach shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells and cells in seminifereus ducts.](http://images.novusbio.com/fullsize/UFL1-Antibody-Immunohistochemistry-Paraffin-NBP1-90692-img0025.jpg "Immunohistochemistry-Paraffin: UFL1 Antibody [NBP1-90692] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells and cells in seminifereus ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
