![Western Blot: UFM1 Antibody [NBP2-94235] - Western blot analysis of extracts of various cell lines, using UFM1 antibody (NBP2-94235) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/UFM1 Antibody-Western Blot-NBP2-94235-img0004.jpg "Western Blot: UFM1 Antibody [NBP2-94235] - Western blot analysis of extracts of various cell lines, using UFM1 antibody (NBP2-94235) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UFM1 (NP_057701.1). MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UFM1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for UFM1 Antibody (NBP2-94235)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UFM1 |
![Immunohistochemistry-Paraffin: UFM1 Antibody [NBP2-94235] - Immunohistochemistry of paraffin-embedded mouse brain using UFM1 Rabbit pAb (NBP2-94235) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UFM1-Antibody-Immunohistochemistry-Paraffin-NBP2-94235-img0003.jpg "Immunohistochemistry-Paraffin: UFM1 Antibody [NBP2-94235] - Immunohistochemistry of paraffin-embedded mouse brain using UFM1 Rabbit pAb (NBP2-94235) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] - Immunofluorescence analysis of NIH/3T3 cells using UFM1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94235_rabbit-polyclonal-ufm1-antibody-5220251629397.jpg "Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] - Immunofluorescence analysis of NIH/3T3 cells using UFM1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] - Immunofluorescence analysis of U2OS cells using UFM1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94235_rabbit-polyclonal-ufm1-antibody-52202516345227.jpg "Immunocytochemistry/ Immunofluorescence: UFM1 Antibody - Azide and BSA Free [UFM1] - Immunofluorescence analysis of U2OS cells using UFM1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")