u-Plasminogen Activator/Urokinase Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PLAU |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for u-Plasminogen Activator/Urokinase Antibody
Background
Urokinase specifically cleave the zymogen plasminogen to form the active enzyme plasmin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: PAGE
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC
Publications for u-Plasminogen Activator/Urokinase Antibody (NBP3-21338) (0)
There are no publications for u-Plasminogen Activator/Urokinase Antibody (NBP3-21338).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for u-Plasminogen Activator/Urokinase Antibody (NBP3-21338) (0)
There are no reviews for u-Plasminogen Activator/Urokinase Antibody (NBP3-21338).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for u-Plasminogen Activator/Urokinase Antibody (NBP3-21338) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional u-Plasminogen Activator/Urokinase Products
Research Areas for u-Plasminogen Activator/Urokinase Antibody (NBP3-21338)
Find related products by research area.
|
Blogs on u-Plasminogen Activator/Urokinase