![Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Analysis in human parathyroid gland and liver tissues using NBP1-86240 antibody. Corresponding TMC3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TMC3-Antibody-Immunohistochemistry-Paraffin-NBP1-86240-img0009.jpg "Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Analysis in human parathyroid gland and liver tissues using NBP1-86240 antibody. Corresponding TMC3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRNASQCYLYQESLLLSNLDDSFSADETGDSNDPEQIFQNIQFQKDLMANIRCRPWTMGQKLRALRQAKNIVLKFEGRLTRTRGYQAAG |
| Predicted Species | Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMC3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMC3 |
![Immunocytochemistry/Immunofluorescence: TMC3 Antibody [NBP1-86240] - Staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize/TMC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86240-img0008.jpg "Immunocytochemistry/Immunofluorescence: TMC3 Antibody [NBP1-86240] - Staining of human cell line U-251 MG shows localization to cytosol.")
![Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human tonsil shows no positivity as expected.](http://images.novusbio.com/fullsize/TMC3-Antibody-Immunohistochemistry-Paraffin-NBP1-86240-img0012.jpg "Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human tonsil shows no positivity as expected.")
![Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TMC3-Antibody-Immunohistochemistry-Paraffin-NBP1-86240-img0010.jpg "Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/TMC3-Antibody-Immunohistochemistry-Paraffin-NBP1-86240-img0011.jpg "Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/TMC3-Antibody-Immunohistochemistry-Paraffin-NBP1-86240-img0013.jpg "Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Immunohistochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Immunohistochemistry_15873.jpg)
![Immunocytochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin-13_AF3264_Immunocytochemistry_6491.jpg)
![Simple Western Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Simple_Western_17005.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412514869.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412505322.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")