Home » TKTL1 » TKTL1 Proteins » TKTL1 Recombinant Protein Antigen

TKTL1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TKTL1 Recombinant Protein Antigen (NBP1-86939PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

TKTL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TKTL1.

Source: E. coli

Amino Acid Sequence: SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TKTL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86939.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TKTL1 Recombinant Protein Antigen

  • TK 2
  • TKR EC 2.2.1.1
  • TKR
  • TKT2Transketolase 2
  • transketolase-2
  • transketolase-like 1
  • transketolase-like protein 1
  • Transketolase-related protein

Background

Transketolase is a thiamine-dependent enzyme that links the pentose phosphate pathway with the glycolytic pathway. TKTL1 is a transketolase-related protein. TKTL1 is upregulated in many cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Transketolase
Antibody - BSA Free
NBP1-87441
Immunohistochemistry-Paraffin Transketolase Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Transketolase Antibody - BSA Free
Western Blot Transketolase Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(71 Publications)
Species: Hu
Applications: ELISA
DDR2 Antibody
[Unconjugated]
AF2538
Simple Western DDR2 Antibody [Unconjugated]
Knockdown Validated DDR2 Antibody [Unconjugated]
Western Blot DDR2 Antibody [Unconjugated]
(3 Reviews)
(14 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(69 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Sulfamidase/SGSH
Antibody - BSA Free
NBP1-83164
Western Blot Sulfamidase/SGSH Antibody - BSA Free
Immunohistochemistry-Paraffin Sulfamidase/SGSH Antibody - BSA Free
Immunohistochemistry-Paraffin Sulfamidase/SGSH Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
GFER/ALR Antibody
(829812)
MAB7940
Immunohistochemistry GFER/ALR Antibody (829812)
Western Blot GFER/ALR Antibody (829812)
(1 Publication)
Species: Hu
Applications: IHC, WB
SPAG9 Antibody -
BSA Free
NBP1-85393
Immunocytochemistry/ Immunofluorescence SPAG9 Antibody - BSA Free
Immunohistochemistry-Paraffin SPAG9 Antibody - BSA Free
Immunohistochemistry-Paraffin SPAG9 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PANK2 Antibody
(OTI3H9)
NBP2-02677
Flow Cytometry PANK2 Antibody (OTI3H9)
Flow Cytometry PANK2 Antibody (OTI3H9)
Western Blot PANK2 Antibody (OTI3H9)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
MED12 Antibody -
BSA Free
NB100-2357
Immunohistochemistry MED12 Antibody - BSA Free
Western Blot MED12 Antibody - BSA Free
Western Blot MED12 Antibody - BSA Free
(13 Publications)
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
TKTL2 Antibody -
BSA Free
NBP2-20650
Western Blot TKTL2 Antibody - BSA Free
Western Blot TKTL2 Antibody - BSA Free
Species: Hu, Mu
Applications: WB
Coagulation Factor
X Antibody - BSA Free ...
NBP1-33320
Western Blot Coagulation Factor X Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Coagulation Factor X Antibody - BSA Free
Immunohistochemistry-Paraffin Coagulation Factor X Antibody - BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(686 Publications)
Species: Hu
Applications: ELISA
TKTL1 Recombinant
Protein Antigen
NBP1-86939PEP
TKTL1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TKTL1 Recombinant Protein Antigen (NBP1-86939PEP) (0)

There are no publications for TKTL1 Recombinant Protein Antigen (NBP1-86939PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TKTL1 Recombinant Protein Antigen (NBP1-86939PEP) (0)

There are no reviews for TKTL1 Recombinant Protein Antigen (NBP1-86939PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TKTL1 Recombinant Protein Antigen (NBP1-86939PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TKTL1 Products

Blogs on TKTL1

There are no specific blogs for TKTL1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TKTL1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TKTL1