Home » TERF2IP » TERF2IP Proteins » TERF2IP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TERF2IP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TERF2IP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TERF2IP.

Source: E. coli

Amino Acid Sequence: REFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TERF2IP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82433.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TERF2IP Recombinant Protein Antigen

  • dopamine receptor interacting protein 5
  • Dopamine receptor-interacting protein 5
  • DRIP5
  • hRap1
  • RAP1 homolog
  • RAP1TERF2-interacting telomeric protein 1
  • Repressor/activator protein 1 homolog
  • telomeric repeat binding factor 2, interacting protein
  • telomeric repeat-binding factor 2-interacting protein 1
  • TRF2-interacting telomeric protein 1
  • TRF2-interacting telomeric RAP1 protein

Background

Mammalian telomeric proteins, including TRF1, TRF2, tankyrase, and TIN2 have no recognized orthologs in budding yeast. However, human Rap1 (hRap1) is an ortholog of the yeast telomeric protein, scRap1p. hRap1 is a homodimer, has three conserved sequence motifs in common with scRap1, is located at telomeres, and plays a role in telomere length regulation. Although scRap1 binds telomeric DNA directly, hRap1 is recruited to telomeres by TRF2 and binds it with its C-terminus, rather than directly binding DNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RAPGEF3 Antibody -
BSA Free
NBP2-81767
Western Blot RAPGEF3 Antibody - BSA Free
Immunohistochemistry RAPGEF3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence RAPGEF3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TRF-2 Antibody -
BSA Free
NB110-57130
Flow Cytometry TRF-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free
(2 Reviews)
(148 Publications)
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Rap2A Antibody -
BSA Free
NBP2-24574
Immunohistochemistry-Paraffin Rap2A Antibody - BSA Free
Western Blot Rap2A Antibody - BSA Free
(1 Publication)
Species: Ca, Ch, Eq, Hu, Mu, Ma-Op, Pm, Xp
Applications: IHC, IHC-P, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
LRPAP Antibody
NBP1-89334
Immunocytochemistry/ Immunofluorescence LRPAP Antibody
Immunohistochemistry-Paraffin LRPAP Antibody
Immunohistochemistry LRPAP Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Rap1A/B Antibody
[Unconjugated]
AF3767
Western Blot Rap1A/B Antibody [Unconjugated]
Western Blot Rap1A/B Antibody [Unconjugated]
Immunohistochemistry Rap1A/B Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SOS2 Antibody
[Unconjugated]
AF6260
Western Blot SOS2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
GRF2 Antibody
(OTI2F5)
NBP2-45515
Immunofluorescence GRF2 Antibody (OTI2F5)
Immunohistochemistry GRF2 Antibody (OTI2F5)
Immunohistochemistry GRF2 Antibody (OTI2F5)
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TRF-1 Antibody
(57-6)
NB110-68281
Flow Cytometry TRF-1 Antibody (57-6)
Western Blot TRF-1 Antibody (57-6)
Western Blot TRF-1 Antibody (57-6)
(6 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
RAP1GAP Antibody
NBP1-83002
Immunohistochemistry RAP1GAP Antibody
Immunohistochemistry RAP1GAP Antibody
Immunohistochemistry RAP1GAP Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
TERF2IP
Recombinant Protein A
NBP1-82433PEP
TERF2IP Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP) (0)

There are no publications for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP) (0)

There are no reviews for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TERF2IP Products

Research Areas for TERF2IP Recombinant Protein Antigen (NBP1-82433PEP)

Find related products by research area.

Blogs on TERF2IP

There are no specific blogs for TERF2IP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: TRF-2 Antibody [NB110-57130] - An intracellular stain was performed on HeLa cells with TRF-2 Antibody NB110-57130AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
TRF-2 Antibody - BSA Free
NB110-57130

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TERF2IP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TERF2IP