![Western Blot: TBRG4 Antibody [NBP1-85478] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TBRG4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/TBRG4-Antibody-Western-Blot-NBP1-85478-img0010.jpg "Western Blot: TBRG4 Antibody [NBP1-85478] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TBRG4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TBRG4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TBRG4 Antibody (NBP1-85478)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBRG4 |
![Immunocytochemistry/Immunofluorescence: TBRG4 Antibody [NBP1-85478] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TBRG4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85478-img0008.jpg "Immunocytochemistry/Immunofluorescence: TBRG4 Antibody [NBP1-85478] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/antibody/nbp1-85478_rabbit-polyclonal-tbrg4-antibody-immunohistochemistry-paraffin-1172023125756..jpg "Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] -Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-85478_rabbit-polyclonal-tbrg4-antibody-immunohistochemistry-paraffin-117202312591..jpg "Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] -Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] -Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyoctes.](http://images.novusbio.com/fullsize/antibody/nbp1-85478_rabbit-polyclonal-tbrg4-antibody-immunohistochemistry-paraffin-117202313013..jpg "Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] -Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyoctes.")
![Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] -Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/antibody/nbp1-85478_rabbit-polyclonal-tbrg4-antibody-immunohistochemistry-paraffin-117202313123..jpg "Immunohistochemistry-Paraffin: TBRG4 Antibody [NBP1-85478] -Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")