Novus Biologicals products are now on bio-techne.com

SUMO2 Recombinant Protein Antigen

Images

 
There are currently no images for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

SUMO2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUMO2.

Source: E. coli

Amino Acid Sequence: HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUMO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46758.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SUMO2 Recombinant Protein Antigen

  • HSMT3
  • MGC117191
  • sentrin 2
  • Sentrin-2
  • small ubiquitin-like modifier 2
  • small ubiquitin-related modifier 2
  • SMT3 (suppressor of mif two 3, yeast) homolog 2
  • SMT3 homolog 2
  • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
  • SMT3 suppressor of mif two 3 homolog 2 (yeast)
  • SMT3A
  • SMT3B
  • SMT3H2
  • SUMO2
  • SUMO-2
  • SUMO3
  • SUMO-3
  • Ubiquitin-like protein SMT3A
  • ubiquitin-like protein SMT3B

Background

Function: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4; Subcellular location: Nucleus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-812
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-56590
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-56405
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
NBP2-03852
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-68864
Species: Mu
Applications: PEP-ELISA, WB
H00026054-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB600-1318
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77158
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP) (0)

There are no publications for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP) (0)

There are no reviews for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SUMO2 Products

Research Areas for SUMO2 Recombinant Protein Antigen (NBP2-46758PEP)

Find related products by research area.

Blogs on SUMO2.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SUMO2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMO2