![Western Blot: STRA6 Antibody [NBP1-83719] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize/STRA6-Antibody-Western-Blot-NBP1-83719-img0012.jpg "Western Blot: STRA6 Antibody [NBP1-83719] - Analysis in human cell line SH-SY5Y.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STRA6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83719 | Applications | Species |
|---|---|---|
| Zhou C, H�neke T, Rohner E et al. STRA6 is essential for induction of vascular smooth muscle lineages in human embryonic cardiac outflow tract development Cardiovascular Research 2023-05-22 [PMID: 36635482] (Western Blot, Block/Neutralize) | Western Blot, Block/Neutralize |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STRA6 |
![Immunocytochemistry/Immunofluorescence: STRA6 Antibody [NBP1-83719] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & cytosol.](http://images.novusbio.com/fullsize/STRA6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83719-img0003.jpg "Immunocytochemistry/Immunofluorescence: STRA6 Antibody [NBP1-83719] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & cytosol.")
![Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.](http://images.novusbio.com/fullsize/STRA6-Antibody-Immunohistochemistry-Paraffin-NBP1-83719-img0011.jpg "Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.")
![Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/STRA6-Antibody-Immunohistochemistry-Paraffin-NBP1-83719-img0006.jpg "Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human kidney shows strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/STRA6-Antibody-Immunohistochemistry-Paraffin-NBP1-83719-img0008.jpg "Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human testis shows weak membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/STRA6-Antibody-Immunohistochemistry-Paraffin-NBP1-83719-img0009.jpg "Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human testis shows weak membranous positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/STRA6-Antibody-Immunohistochemistry-Paraffin-NBP1-83719-img0010.jpg "Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
![N/A RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/RBP4_DRB400_ELISA_169.jpg)
![N/A RBP4/Retinol-Binding Protein 4 [HRP]](https://images.novusbio.com/images2/DATA_RBP4_DRB400_ELISA_804.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot SOCS-3 Antibody (516919) [Unconjugated]](https://images.novusbio.com/images2/SOCS-3_MAB5696_Western_Blot_6252.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")