Home » STAM-1 » STAM-1 Antibodies » STAM-1 Antibody
Novus Biologicals products are now on bio-techne.com

STAM-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: STAM-1 Antibody [NBP2-38514] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Western Blot: STAM-1 Antibody [NBP2-38514] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: STAM-1 Antibody [NBP2-38514] - Staining of human cell line CACO-2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and leydig cells.
Immunohistochemistry-Paraffin: STAM-1 Antibody [NBP2-38514] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

STAM-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STAM-1 Protein (NBP2-38514PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAM-1 Antibody

  • DKFZp686J2352
  • HSE1 Homolog
  • signal transducing adapter molecule 1
  • signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
  • STAM
  • STAM1
  • STAM-1
  • STAM1STAM-1

Background

STAM was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS/HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HGS Antibody (6D11)
H00009146-M01
Immunocytochemistry/ Immunofluorescence HGS Antibody (6D11)
Western Blot HGS Antibody (6D11)
Sandwich ELISA HGS Antibody (6D11)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
SFRS5 Antibody
H00006430-B01P
Immunohistochemistry SFRS5 Antibody
Immunocytochemistry/ Immunofluorescence SFRS5 Antibody
Immunohistochemistry-Paraffin SFRS5 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HARS Antibody
NBP1-89490
Immunocytochemistry/ Immunofluorescence HARS Antibody
Immunohistochemistry-Paraffin HARS Antibody
Immunohistochemistry-Paraffin HARS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
STAM2 Antibody
NBP1-83289
Immunohistochemistry-Paraffin STAM2 Antibody
Immunohistochemistry-Paraffin STAM2 Antibody
Immunohistochemistry-Paraffin STAM2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
AMSH/STAMBP
Antibody [Unconjugate
AF5650
Western Blot AMSH/STAMBP Antibody [Unconjugated]
Immunohistochemistry AMSH/STAMBP Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
TOM1 Antibody
NBP1-86170
Western Blot TOM1 Antibody
Immunohistochemistry-Paraffin TOM1 Antibody
Immunohistochemistry-Paraffin TOM1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
UCH-L3 Antibody
NBP1-86037
Immunocytochemistry/ Immunofluorescence UCH-L3 Antibody
Immunohistochemistry-Paraffin UCH-L3 Antibody
Immunohistochemistry-Paraffin UCH-L3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(795 Publications)
Species: Hu
Applications: BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
UBPY/USP8 Antibody
NBP2-20792
Immunoprecipitation UBPY/USP8 Antibody
Immunocytochemistry/ Immunofluorescence UBPY/USP8 Antibody
Western Blot UBPY/USP8 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Jak3 Antibody
(5H2) - BSA Free
NBP2-37737
Western Blot Jak3 Antibody (5H2) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak3 Antibody (5H2) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak3 Antibody (5H2) - BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for STAM-1 Antibody (NBP2-38514) (0)

There are no publications for STAM-1 Antibody (NBP2-38514).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAM-1 Antibody (NBP2-38514) (0)

There are no reviews for STAM-1 Antibody (NBP2-38514). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAM-1 Antibody (NBP2-38514) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAM-1 Products

Research Areas for STAM-1 Antibody (NBP2-38514)

Find related products by research area.

Blogs on STAM-1

There are no specific blogs for STAM-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAM-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol STAM
Uniprot