Home » STAG2 » STAG2 Proteins » STAG2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

STAG2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for STAG2 Protein (NBP1-87096PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

STAG2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAG2.

Source: E. coli

Amino Acid Sequence: LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STAG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87096.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STAG2 Recombinant Protein Antigen

  • bA517O1.1
  • cohesin subunit SA-2
  • DKFZp686P168
  • SA-2
  • SA2FLJ25871
  • SCC3 homolog 2
  • stromal antigen 2DKFZp781H1753

Background

SA2 is a component of the cohesin complex, which is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which, sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. The subunit interacts directly with RAD21 in cohesin complex. Cohesin complexes are composed of a heterodimer between a SMC1 protein (SMC1L1 or SMC1L2) and SMC3, which are attached via their hinge domain, and RAD21 links them at their heads, and one STAG protein (STAG1, STAG2 or STAG3). In cohesin complexes, STAG2 is mutually exclusive with STAG1 and STAG3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SA1 Antibody
NBP1-87097
Western Blot SA1 Antibody
Immunohistochemistry-Paraffin SA1 Antibody
Immunohistochemistry-Paraffin SA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Rad21 Antibody
NBP2-20053
Immunohistochemistry-Paraffin Rad21 Antibody
Immunohistochemistry-Paraffin Rad21 Antibody
Immunocytochemistry/ Immunofluorescence Rad21 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
SMC1 Antibody
NB100-204
Immunohistochemistry-Paraffin SMC1 Antibody
Immunohistochemistry-Paraffin SMC1 Antibody
Unknown SMC1 Antibody
(36 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
SMC3 Antibody
NB100-207
Unknown SMC3 Antibody
Western Blot SMC3 Antibody
Immunohistochemistry-Paraffin SMC3 Antibody
(9 Publications)
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
DEP-1/CD148
Antibody (143-41)
MAB1934
Western Blot DEP-1/CD148 Antibody (143-41)
(2 Reviews)
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
TMEPAI Antibody
(2A12)
H00056937-M01
ELISA TMEPAI Antibody (2A12)
(13 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Separase Antibody
(6H6)
H00009700-M01
Western Blot Separase Antibody (6H6)
Immunohistochemistry-Paraffin Separase Antibody (6H6)
(14 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TLR7 Antibody -
BSA Free
NBP2-24906
Immunocytochemistry/ Immunofluorescence TLR7 Antibody - BSA Free
Immunohistochemistry-Frozen TLR7 Antibody - BSA Free
Immunohistochemistry TLR7 Antibody - BSA Free
(4 Reviews)
(80 Publications)
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
REC8 Antibody
NBP1-87145
Immunocytochemistry/ Immunofluorescence REC8 Antibody
Immunohistochemistry-Paraffin REC8 Antibody
Immunohistochemistry-Paraffin REC8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CTCF Antibody
(CL0307)
NBP2-52911
Immunohistochemistry-Paraffin CTCF Antibody (CL0307)
Immunohistochemistry-Paraffin CTCF Antibody (CL0307)
Immunohistochemistry-Paraffin CTCF Antibody (CL0307)
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TIN2 Antibody
NBP2-55709
Western Blot TIN2 Antibody
Immunocytochemistry/ Immunofluorescence TIN2 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
ACSM3 Antibody
H00006296-D01P
Western Blot ACSM3 Antibody
Western Blot ACSM3 Antibody
Species: Hu, Mu
Applications: WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
IGF-II/IGF2
[Unconjugated]
292-G2
SDS-PAGE IGF-II/IGF2 [Unconjugated]
Bioactivity IGF-II/IGF2 [Unconjugated]
(48 Publications)
Species: Hu
Applications: BA
RPSA Antibody
(RPSA/2699) - Azide a ...
NBP2-79854
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for STAG2 Protein (NBP1-87096PEP) (0)

There are no publications for STAG2 Protein (NBP1-87096PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAG2 Protein (NBP1-87096PEP) (0)

There are no reviews for STAG2 Protein (NBP1-87096PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STAG2 Protein (NBP1-87096PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STAG2 Products

Array NBP1-87096PEP

Research Areas for STAG2 Protein (NBP1-87096PEP)

Find related products by research area.

Blogs on STAG2

There are no specific blogs for STAG2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: STAG2 Antibody (3C6) [H00010735-M01] - Staining of human HCT116 fixed cells. Image provided by product review by verified customer.
STAG2 Antibody (3C6)
H00010735-M01
Immunocytochemistry/Immunofluorescence: TLR7 Antibody [NBP2-24906] - Analysis using the Azide Free version of NBP2-24906. Staining of Raw 246.7 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x. An antibody dilution of 1:10 was used.
TLR7 Antibody - BSA Free
NBP2-24906

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STAG2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol STAG2