Home » SRGN » SRGN Antibodies » SRGN Antibody - BSA Free

SRGN Antibody - BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SRGN Antibody [NBP1-80447] - Host: Rabbit. Target Name: SRGN. Sample Tissue: Human U937 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: SRGN Antibody [NBP1-80447] - Host: Rabbit. Target Name: SRGN. Sample Tissue: Human U937 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: SRGN Antibody [NBP1-80447] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

Novus Biologicals offers 100% Guarantee

SRGN Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human SRGN. Peptide sequence RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SRGN Antibody - BSA Free

  • FLJ12930
  • Hematopoetic proteoglycan core protein
  • MGC9289
  • P.PG
  • Platelet proteoglycan core protein
  • platelet proteoglycan protein core
  • PPG
  • PRG1p.PG
  • PRGhematopoetic proteoglycan core peptide
  • proteoglycan 1, secretory granule
  • proteoglycan protein core for mast cell secretory granule
  • secretory granule proteoglycan 1
  • secretory granule proteoglycan core peptide
  • Secretory granule proteoglycan core protein
  • serglycin proteoglycan
  • Serglycin
  • SRGN

Background

SRGN encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(824 Publications)
Species: Hu
Applications: BA
Decorin Antibody
[Unconjugated]
AF1060
Simple Western Decorin Antibody [Unconjugated]
Western Blot Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
IER3 Antibody -
BSA Free
NBP1-76802
Immunohistochemistry IER3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence IER3 Antibody - BSA Free
Western Blot IER3 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Cystathionase
Antibody (4E1-1B7) - ...
H00001491-M01
Western Blot Cystathionase Antibody (4E1-1B7) - Azide and BSA Free
Western Blot Cystathionase Antibody (4E1-1B7) - Azide and BSA Free
Immunohistochemistry-Paraffin Cystathionase Antibody (4E1-1B7) - Azide and BSA Free
(32 Publications)
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(141 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(171 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
ASAH1 Antibody -
BSA Free
NBP1-89296
Immunohistochemistry-Paraffin ASAH1 Antibody - BSA Free
Immunohistochemistry-Paraffin ASAH1 Antibody - BSA Free
Immunohistochemistry-Paraffin ASAH1 Antibody - BSA Free
(7 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Vitamin D BP
Antibody - BSA Free
NBP1-88027
Western Blot Vitamin D BP Antibody - BSA Free
Western Blot Vitamin D BP Antibody - BSA Free
Western Blot Vitamin D BP Antibody - BSA Free
(2 Reviews)
(2 Publications)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunofluorescence HSD17B4 Antibody (OTI4C4)
Immunohistochemistry HSD17B4 Antibody (OTI4C4)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
ARHGEF11 Antibody
- BSA Free
NBP1-83314
Western Blot ARHGEF11 Antibody - BSA Free
Immunohistochemistry-Paraffin ARHGEF11 Antibody - BSA Free
Immunohistochemistry-Paraffin ARHGEF11 Antibody - BSA Free
(2 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, WB
CS Citrate
Synthase Antibody (17 ...
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761) - Azide and BSA Free
Western Blot CS Citrate Synthase Antibody (1761) - Azide and BSA Free
Western Blot CS Citrate Synthase Antibody (1761) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
SRGN Antibody -
BSA Free
NBP1-80447
SRGN Antibody - BSA Free
Species: Hu
Applications: WB

Publications for SRGN Antibody (NBP1-80447) (0)

There are no publications for SRGN Antibody (NBP1-80447).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGN Antibody (NBP1-80447) (0)

There are no reviews for SRGN Antibody (NBP1-80447). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGN Antibody (NBP1-80447) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRGN Products

Research Areas for SRGN Antibody (NBP1-80447)

Find related products by research area.

Blogs on SRGN

There are no specific blogs for SRGN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGN Antibody - BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol SRGN
Uniprot