![Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).](http://images.novusbio.com/fullsize/Vitamin-D-BP-Antibody-Western-Blot-NBP1-88027-img0008.jpg "Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).")
| Reactivity | Hu, Mu, Rt, EqSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Vitamin D BP antibody validated for Simple Western from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Shavahn Loux |
WB | Equine | 02/02/2020 |
Summary
Comments
|
||||||||||
|
reviewed by:
Verified Customer |
Simple Western | Rat | 05/25/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Vitamin D BP Antibody (NBP1-88027)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Shavahn Loux 02/02/2020 |
||
| Application: | WB | |
| Species: | Equine |
| Verified Customer 05/25/2017 |
||
| Application: | Simple Western | |
| Species: | Rat |
| Gene Symbol | GC |
![Western Blot: Vitamin D BP Antibody [NBP1-88027] - Equine adult and embryonic liver cell lysates. WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Vitamin-D-BP-Antibody-Western-Blot-NBP1-88027-img0009.jpg "Western Blot: Vitamin D BP Antibody [NBP1-88027] - Equine adult and embryonic liver cell lysates. WB image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027] - Staining of human liver shows cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Vitamin-D-BP-Antibody-Immunohistochemistry-Paraffin-NBP1-88027-img0006.jpg "Immunohistochemistry-Paraffin: Vitamin D BP Antibody [NBP1-88027] - Staining of human liver shows cytoplasmic positivity in hepatocytes.")
![Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Vitamin-D-BP-Antibody-Western-Blot-NBP1-88027-img0007.jpg "Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A SHBG [HRP]](https://images.novusbio.com/images2/SHBG_DSHBG0_ELISA_1106.jpg)
![N/A SHBG [HRP]](https://images.novusbio.com/images2/SHBG_DSHBG0_ELISA_1107.jpg)
![N/A SHBG [HRP]](https://images.novusbio.com/images2/SHBG_DSHBG0_ELISA_2581.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
