Home » SPRR1B » SPRR1B Proteins » Recombinant Human SPRR1B GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SPRR1B GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human SPRR1B Protein [H00006699-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human SPRR1B Protein [H00006699-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SPRR1B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32509 of Human SPRR1B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SPRR1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPRR1B GST (N-Term) Protein

  • 14.9 kDa pancornulin
  • cornifin B
  • CORNIFIN
  • cornifin-B
  • GADD33
  • MGC61901
  • small proline-rich protein 1B
  • Small proline-rich protein IB
  • SPR-IB
  • SPRR1

Background

SPRR1B( AAH56240, 1 a.a. - 90 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Involucrin
Antibody (SY5) - BSA
NB100-2727
Immunohistochemistry-Paraffin Involucrin Antibody (SY5) - BSA Free
Western Blot Involucrin Antibody (SY5) - BSA Free
(1 Review)
(2 Publications)
Species: Ca, Hu, Po, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
SPRR3 Antibody
NBP2-13374
Immunohistochemistry-Paraffin SPRR3 Antibody
Immunohistochemistry-Paraffin SPRR3 Antibody
Immunohistochemistry-Paraffin SPRR3 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ERK5/BMK1 Antibody
[Unconjugated]
AF2848
Western Blot ERK5/BMK1 Antibody [Unconjugated]
Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
S100A1 Antibody
NBP1-87103
Western Blot S100A1 Antibody
Immunohistochemistry-Paraffin S100A1 Antibody
Immunohistochemistry-Paraffin S100A1 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Autoimmune
Regulator/AIRE Antibo
NB100-1063
Western Blot Autoimmune Regulator/AIRE Antibody
Immunohistochemistry-Paraffin Autoimmune Regulator/AIRE Antibody
Flow Cytometry Autoimmune Regulator/AIRE Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
SPRR2A Antibody
(OTI4B3)
NBP2-45955
Western Blot SPRR2A Antibody (OTI4B3)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Trichohyalin
Antibody
NBP1-80687
Immunohistochemistry-Paraffin Trichohyalin Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
SPRR1B GST (N-Term) P ...
H00006699-P01
Recombinant Human SPRR1B GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for SPRR1B Recombinant Protein (H00006699-P01) (0)

There are no publications for SPRR1B Recombinant Protein (H00006699-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRR1B Recombinant Protein (H00006699-P01) (0)

There are no reviews for SPRR1B Recombinant Protein (H00006699-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPRR1B Recombinant Protein (H00006699-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPRR1B Products

Array H00006699-P01

Blogs on SPRR1B

There are no specific blogs for SPRR1B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
c-Fos Antibody (2H2)
NBP2-50037
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
p38 alpha Antibody [Unconjugated]
AF8691

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPRR1B GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SPRR1B