![Western Blot: SP4 Antibody [NBP2-95181] - Analysis of extracts of various cell lines, using SP4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.](http://images.novusbio.com/fullsize/SP4-Antibody-Western-Blot-NBP2-95181-img0001.jpg "Western Blot: SP4 Antibody [NBP2-95181] - Analysis of extracts of various cell lines, using SP4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 280-440 of human SP4 (NP_003103.2). TGQVGQPAATADSGTSNGNQLVSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQYASTSASSSERTIEESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SP4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 81 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
![Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Block_Neutralize_1519.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_22159.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_6888.jpg)
Secondary Antibodies |
Isotype Controls |
|
Nur77 Activation and Tumor Suppression Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SP4 |
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_6778.jpg)
![Immunohistochemistry VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R1_AF321_Immunohistochemistry_9337.jpg)
![Western Blot VEGFR1/Flt-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af321_human-vegf-r1-flt-1-affinity-purified-polyclonal-ab-8220249511449.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")