![SDS-Page: Recombinant Human Smoothened Protein [H00006608-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00006608-Q01-1.jpg "SDS-Page: Recombinant Human Smoothened Protein [H00006608-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 56-155 of Human Smoothened Source: Wheat Germ (in vitro) Amino Acid Sequence: GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | SMO |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Smoothened Partial Recombinant Protein (H00006608-Q01)Find related products by research area.
|
|
The role of Smoothened in pulmonary pathologies The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche... Read full blog post. |
|
Pancreatic Cancer Research Targets Hedgehog Signaling Pathway The Hedgehog Signaling Pathway (HSP) is an important pathway involved in embryonic development by regulating cell differentiation. This pathway has also become an increasingly hot topic in cancer research in recent years. The HSP involves the interact... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMO |
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Hip Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Hip Antibody [Unconjugated]")
![Immunohistochemistry Desert Hedgehog/Dhh Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af196_mouse-desert-hedgehog-dhh-c-terminus-affinity-purified-pab-8220249511434.jpg)
![Immunohistochemistry Desert Hedgehog/Dhh Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af196_mouse-desert-hedgehog-dhh-c-terminus-affinity-purified-pab-44202415425011.jpg)