![Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/CCDC6-Antibody-Western-Blot-NBP1-85351-img0007.jpg "Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCDC6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
|
The role of Smoothened in pulmonary pathologies The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCDC6 |
![Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85351-img0013.jpg "Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0021.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CCDC6-Antibody-Western-Blot-NBP1-85351-img0005.jpg "Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0009.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0010.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0012.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human testis.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0015.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human testis.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0016.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human colon.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0017.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human colon.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Analysis in human fallopian tube and liver tissues. Corresponding CCDC6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0018.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Analysis in human fallopian tube and liver tissues. Corresponding CCDC6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube, liver, skin and testis using Anti-CCDC6 antibody NBP1-85351 (A) shows similar protein distribution across tissues to independent antibody NBP1-85350 (B).](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0019.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube, liver, skin and testis using Anti-CCDC6 antibody NBP1-85351 (A) shows similar protein distribution across tissues to independent antibody NBP1-85350 (B).")
![Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CCDC6-Antibody-Immunohistochemistry-Paraffin-NBP1-85351-img0020.jpg "Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")