Home » SIX6 » SIX6 Proteins » SIX6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SIX6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SIX6 Recombinant Protein Antigen (NBP1-82478PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SIX6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIX6.

Source: E. coli

Amino Acid Sequence: YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82478.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIX6 Recombinant Protein Antigen

  • homeobox protein SIX6
  • Homeodomain protein OPTX2
  • MCOPCT2
  • Optic homeobox 2
  • OPTX2
  • sine oculis homeobox (Drosophila) homolog 6
  • sine oculis homeobox homolog 6 (Drosophila)
  • Sine oculis homeobox homolog 6
  • SIX homeobox 6
  • Six9

Background

The protein encoded by the Homeobox protein SIX6 gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in eye development. Defects in this gene are a cause of isolated microphthalmia with cataract type 2 (MCOPCT2). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SIX3 Antibody (1A2)
H00006496-M04
Western Blot SIX3 Antibody (1A2)
Western Blot SIX3 Antibody (1A2)
Western Blot SIX3 Antibody (1A2)
Species: Hu
Applications: ELISA, WB
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
SIX1 Antibody
NBP1-84264
Immunohistochemistry-Paraffin SIX1 Antibody
Immunohistochemistry-Paraffin SIX1 Antibody
Immunohistochemistry-Paraffin SIX1 Antibody
(18 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, WB
RAX Antibody
NB100-56467
Western Blot RAX Antibody
Species: Ca, Hu, Pm
Applications: WB
CHX10 Antibody
NBP1-84476
Immunohistochemistry-Paraffin CHX10 Antibody
Immunohistochemistry-Paraffin CHX10 Antibody
Western Blot CHX10 Antibody
(8 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Otx2 Antibody
[Unconjugated]
AF1979
Immunocytochemistry Otx2 Antibody [Unconjugated]
Immunohistochemistry Otx2 Antibody [Unconjugated]
Simple Western Otx2 Antibody [Unconjugated]
(2 Reviews)
(176 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(519 Publications)
Species: Hu
Applications: BA, BA
LHX2 Antibody
(CL6137)
NBP2-61435
Immunohistochemistry-Paraffin LHX2 Antibody (CL6137)
Western Blot LHX2 Antibody (CL6137)
Western Blot LHX2 Antibody (CL6137)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SIX4 Antibody (7E2)
H00051804-M09
ELISA SIX4 Antibody (7E2)
Knockdown Validated SIX4 Antibody (7E2)
Western Blot SIX4 Antibody (7E2)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
DACH1 Antibody
NBP2-27192
Immunohistochemistry-Paraffin DACH1 Antibody
Western Blot DACH1 Antibody
Species: Bv, Ca, Ch, Eq, Hu, Mu, Pm
Applications: IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
Dkk-1
[Unconjugated]
5439-DK
Cell Culture Dkk-1 [Unconjugated]
Cell Culture Dkk-1 [Unconjugated]
Bioactivity Dkk-1 [Unconjugated]
(90 Publications)
Species: Hu
Applications: BA
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western PKR Antibody (HL71/10) [Unconjugated]
Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]
Western Blot PKR Antibody (HL71/10) [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB
SIX2 Antibody (3D7)
H00010736-M01
Western Blot SIX2 Antibody (3D7)
Immunocytochemistry/ Immunofluorescence SIX2 Antibody (3D7)
Immunocytochemistry/ Immunofluorescence SIX2 Antibody (3D7)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
Recoverin Antibody
(3F6)
H00005957-M37
Western Blot Recoverin Antibody (3F6)
ELISA Recoverin Antibody (3F6)
Immunocytochemistry/ Immunofluorescence Recoverin Antibody (3F6)
Species: Hu
Applications: ELISA, ICC/IF, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
FGF-9
[Unconjugated]
273-F9
Bioactivity FGF-9 [Unconjugated]
(47 Publications)
Species: Hu
Applications: BA

Publications for SIX6 Recombinant Protein Antigen (NBP1-82478PEP) (0)

There are no publications for SIX6 Recombinant Protein Antigen (NBP1-82478PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIX6 Recombinant Protein Antigen (NBP1-82478PEP) (0)

There are no reviews for SIX6 Recombinant Protein Antigen (NBP1-82478PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIX6 Recombinant Protein Antigen (NBP1-82478PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIX6 Products

Research Areas for SIX6 Recombinant Protein Antigen (NBP1-82478PEP)

Find related products by research area.

Blogs on SIX6

There are no specific blogs for SIX6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIX6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SIX6