![Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining in human tonsil and pancreas tissues. Corresponding S100A4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Immunohistochemistry-Paraffin-NBP2-52890-img0010.jpg "Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining in human tonsil and pancreas tissues. Corresponding S100A4 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL0237 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
| Epitope | KFKLNKSELKELLTR |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | S100A4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Mouse | 08/11/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for S100A4 Antibody (NBP2-52890)Find related products by research area.
|
|
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | S100A4 |
![Western Blot: S100A4 Antibody (CL0237) [NBP2-52890] - Lane 1: Marker [kDa], Lane 2: Negative control (vector only transfected HEK293T lysate), Lane 3: S100A4 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Western-Blot-NBP2-52890-img0005.jpg "Western Blot: S100A4 Antibody (CL0237) [NBP2-52890] - Lane 1: Marker [kDa], Lane 2: Negative control (vector only transfected HEK293T lysate), Lane 3: S100A4 Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)")
![Immunocytochemistry/Immunofluorescence: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of A549 cells using the Anti-S100A4 monoclonal antibody, showing specific staining in the plasma membrane and the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Immunocytochemistry-Immunofluorescence-NBP2-52890-img0011.jpg "Immunocytochemistry/Immunofluorescence: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of A549 cells using the Anti-S100A4 monoclonal antibody, showing specific staining in the plasma membrane and the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human tonsil shows moderate to strong cytoplasmic positivity, mainly in non - germinal center cells.](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Immunohistochemistry-Paraffin-NBP2-52890-img0006.jpg "Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human tonsil shows moderate to strong cytoplasmic positivity, mainly in non - germinal center cells.")
![Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Immunohistochemistry-Paraffin-NBP2-52890-img0007.jpg "Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Immunohistochemistry-Paraffin-NBP2-52890-img0008.jpg "Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human pancreas shows no positivity in either islets of Langerhans or exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/S100A4-Antibody-CL0237-Immunohistochemistry-Paraffin-NBP2-52890-img0009.jpg "Immunohistochemistry-Paraffin: S100A4 Antibody (CL0237) [NBP2-52890] - Staining of human pancreas shows no positivity in either islets of Langerhans or exocrine glandular cells as expected.")
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")
