![Western Blot: RTCD1 Antibody [NBP1-87113] - Analysis using Anti-RTCA antibody NBP1-87113 (A) shows similar pattern to independent antibody NBP2-58714 (B).](http://images.novusbio.com/fullsize/RTCD1-Antibody-Western-Blot-NBP1-87113-img0009.jpg "Western Blot: RTCD1 Antibody [NBP1-87113] - Analysis using Anti-RTCA antibody NBP1-87113 (A) shows similar pattern to independent antibody NBP2-58714 (B).")
| Reactivity | Hu, Mu, Rt, DrSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RTCA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC, WB reported in scientific literature (PMID: 25961792). For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87113 | Applications | Species |
|---|---|---|
| Song Y, Sretavan D, Salegio EA et al. Regulation of axon regeneration by the RNA repair/splicing pathway. Nat Neurosci 2015-06-01 [PMID: 25961792] (WB, IF/IHC, Mouse) | WB, IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for RTCD1 Antibody (NBP1-87113)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RTCA |
![Immunocytochemistry/Immunofluorescence: RTCD1 Antibody [NBP1-87113] - Staining of human cell line A-431 shows localization to nucleus.](http://images.novusbio.com/fullsize/RTCD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87113-img0008.jpg "Immunocytochemistry/Immunofluorescence: RTCD1 Antibody [NBP1-87113] - Staining of human cell line A-431 shows localization to nucleus.")
![Immunohistochemistry-Paraffin: RTCD1 Antibody [NBP1-87113] - Staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/RTCD1-Antibody-Immunohistochemistry-Paraffin-NBP1-87113-img0007.jpg "Immunohistochemistry-Paraffin: RTCD1 Antibody [NBP1-87113] - Staining of human kidney shows moderate nuclear and cytoplasmic positivity in cells in tubules.")
![Western Blot: RTCD1 Antibody [NBP1-87113] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/RTCD1-Antibody-Western-Blot-NBP1-87113-img0006.jpg "Western Blot: RTCD1 Antibody [NBP1-87113] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Enzyme Activity Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-enzyme-activity-202202316147.jpg)
![SDS-PAGE Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-sds-page-2022023162028.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")