![Western Blot: RAB34 Antibody [NBP2-85576] - RAB34 antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.](http://images.novusbio.com/fullsize/RAB34-Antibody-Western-Blot-NBP2-85576-img0001.jpg "Western Blot: RAB34 Antibody [NBP2-85576] - RAB34 antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human RAB34. Peptide sequence: FFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTC The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB34 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB34 Antibody (NBP2-85576)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB34 |
![Western Blot: RAB34 Antibody [NBP2-85576] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug). 2. Monkey Fibroblast Cell Lysate (15ug). Primary Dilution: 1:1000. Secondary Antibody. : goat anti-Rabbit. Secondary Dilution: 1:40,000. Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab. University of Arkansas for Medical Sciences](http://images.novusbio.com/fullsize/RAB34-Antibody-Western-Blot-NBP2-85576-img0002.jpg "Western Blot: RAB34 Antibody [NBP2-85576] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug). 2. Monkey Fibroblast Cell Lysate (15ug). Primary Dilution: 1:1000. Secondary Antibody. : goat anti-Rabbit. Secondary Dilution: 1:40,000. Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab. University of Arkansas for Medical Sciences")
![Simple Western BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Simple_Western_16992.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_22585.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_9663.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Immunohistochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunohistochemistry_6668.jpg)
![Immunocytochemistry Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Immunocytochemistry__Immunofluorescence_23054.jpg)
![Western Blot Cathepsin D Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_D_AF1029_Western_Blot_19580.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
